Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Pro-neuregulin-2, membrane-bound isoform (Pro-NRG2) [Cleaved into: Neuregulin-2 (NRG-2) (Divergent of neuregulin-1) (DON-1) (Neural- and thymus-derived activator for ERBB kinases) (NTAK)]

 NRG2_HUMAN              Reviewed;         850 AA.
O14511;
15-DEC-1998, integrated into UniProtKB/Swiss-Prot.
01-JAN-1998, sequence version 1.
12-SEP-2018, entry version 162.
RecName: Full=Pro-neuregulin-2, membrane-bound isoform;
Short=Pro-NRG2;
Contains:
RecName: Full=Neuregulin-2;
Short=NRG-2;
AltName: Full=Divergent of neuregulin-1;
Short=DON-1;
AltName: Full=Neural- and thymus-derived activator for ERBB kinases;
Short=NTAK;
Flags: Precursor;
Name=NRG2; Synonyms=NTAK;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Neuroblastoma;
PubMed=9348101; DOI=10.1093/oxfordjournals.jbchem.a021806;
Higashiyama S., Horikawa M., Yamada K., Ichino N., Nakano N.,
Nakagawa T., Miyagawa J., Matsushita N., Nagatsu T., Taniguchi N.,
Ishiguro H.;
"A novel brain-derived member of the epidermal growth factor family
that interacts with ErbB3 and ErbB4.";
J. Biochem. 122:675-680(1997).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS DON-1B AND DON-1R).
TISSUE=Fetal brain;
PubMed=9199335; DOI=10.1128/MCB.17.7.4007;
Busfield S.J., Michnick D.A., Chickering T.W., Revett T.L., Ma J.,
Woolf E.A., Comrack C.A., Dussault B.J., Woolf J., Goodearl A.D.J.,
Gearing D.P.;
"Characterization of a neuregulin-related gene, Don-1, that is highly
expressed in restricted regions of the cerebellum and hippocampus.";
Mol. Cell. Biol. 17:4007-4014(1997).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND ALTERNATIVE SPLICING (ISOFORMS
1; 2; 3; 4; 5 AND 6).
TISSUE=Fetal brain, and Lung;
PubMed=10369162; DOI=10.1007/s004390050961;
Ring H.Z., Chang H., Guilbot A., Brice A., LeGuern E., Francke U.;
"The human neuregulin 2 (NRG2) gene: cloning, mapping and evaluation
as a candidate for the autosomal recessive form of Charcot-Marie-Tooth
disease linked to 5q.";
Hum. Genet. 104:326-332(1999).
[4]
INTERACTION WITH ERBB4.
PubMed=10867024; DOI=10.1074/jbc.C901015199;
Sweeney C., Lai C., Riese D.J. II, Diamonti A.J., Cantley L.C.,
Carraway K.L. III;
"Ligand discrimination in signaling through an ErbB4 receptor
homodimer.";
J. Biol. Chem. 275:19803-19807(2000).
-!- FUNCTION: Direct ligand for ERBB3 and ERBB4 tyrosine kinase
receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors,
resulting in ligand-stimulated tyrosine phosphorylation and
activation of the ERBB receptors. May also promote the
heterodimerization with the EGF receptor.
-!- SUBUNIT: Interacts with ERBB3 and ERBB4.
{ECO:0000269|PubMed:10867024}.
-!- SUBCELLULAR LOCATION: Pro-neuregulin-2, membrane-bound isoform:
Cell membrane {ECO:0000250}; Single-pass type I membrane protein
{ECO:0000250}. Note=Does not seem to be active. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Neuregulin-2: Secreted {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=1;
IsoId=O14511-1; Sequence=Displayed;
Name=2;
IsoId=O14511-2; Sequence=VSP_003453;
Note=No experimental confirmation available.;
Name=3;
IsoId=O14511-3; Sequence=VSP_003455;
Note=No experimental confirmation available.;
Name=4;
IsoId=O14511-4; Sequence=VSP_003454;
Note=No experimental confirmation available.;
Name=5;
IsoId=O14511-5; Sequence=VSP_003458, VSP_003459;
Note=No experimental confirmation available. May be produced at
very low levels due to a premature stop codon in the mRNA,
leading to nonsense-mediated mRNA decay.;
Name=6;
IsoId=O14511-6; Sequence=VSP_003456, VSP_003457;
Note=No experimental confirmation available.;
Name=DON-1B;
IsoId=O14511-7; Sequence=VSP_003452, VSP_003455;
Name=DON-1R;
IsoId=O14511-8; Sequence=VSP_003451;
-!- TISSUE SPECIFICITY: Restricted to the cerebellum in the adult.
-!- DOMAIN: The cytoplasmic domain may be involved in the regulation
of trafficking and proteolytic processing. Regulation of the
proteolytic processing involves initial intracellular domain
dimerization (By similarity). {ECO:0000250}.
-!- DOMAIN: ERBB receptor binding is elicited entirely by the EGF-like
domain. {ECO:0000250}.
-!- PTM: Proteolytic cleavage close to the plasma membrane on the
external face leads to the release of the soluble growth factor
form. {ECO:0000250}.
-!- PTM: Extensive glycosylation precedes the proteolytic cleavage.
{ECO:0000250}.
-!- SIMILARITY: Belongs to the neuregulin family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB005060; BAA23417.1; -; mRNA.
EMBL; AF119162; AAF28848.1; -; Genomic_DNA.
EMBL; AF119151; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119152; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119153; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119154; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119155; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119158; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119159; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119160; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119161; AAF28848.1; JOINED; Genomic_DNA.
EMBL; AF119162; AAF28849.1; -; Genomic_DNA.
EMBL; AF119151; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119152; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119153; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119154; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119156; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119158; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119159; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119160; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119161; AAF28849.1; JOINED; Genomic_DNA.
EMBL; AF119162; AAF28850.1; -; Genomic_DNA.
EMBL; AF119151; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119152; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119153; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119154; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119155; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119157; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119158; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119159; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119160; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119161; AAF28850.1; JOINED; Genomic_DNA.
EMBL; AF119162; AAF28851.1; -; Genomic_DNA.
EMBL; AF119151; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119152; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119153; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119154; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119156; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119157; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119158; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119159; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119160; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119161; AAF28851.1; JOINED; Genomic_DNA.
EMBL; AF119158; AAF28852.1; -; Genomic_DNA.
EMBL; AF119151; AAF28852.1; JOINED; Genomic_DNA.
EMBL; AF119152; AAF28852.1; JOINED; Genomic_DNA.
EMBL; AF119153; AAF28852.1; JOINED; Genomic_DNA.
EMBL; AF119154; AAF28852.1; JOINED; Genomic_DNA.
EMBL; AF119155; AAF28852.1; JOINED; Genomic_DNA.
EMBL; AF119156; AAF28852.1; JOINED; Genomic_DNA.
EMBL; AF119157; AAF28853.1; -; Genomic_DNA.
EMBL; AF119151; AAF28853.1; JOINED; Genomic_DNA.
EMBL; AF119152; AAF28853.1; JOINED; Genomic_DNA.
EMBL; AF119153; AAF28853.1; JOINED; Genomic_DNA.
EMBL; AF119154; AAF28853.1; JOINED; Genomic_DNA.
EMBL; AF119155; AAF28853.1; JOINED; Genomic_DNA.
EMBL; AF119156; AAF28853.1; JOINED; Genomic_DNA.
CCDS; CCDS4217.1; -. [O14511-1]
PIR; JC5700; JC5700.
RefSeq; NP_001171864.1; NM_001184935.1.
RefSeq; NP_004874.1; NM_004883.2. [O14511-1]
RefSeq; NP_053584.1; NM_013981.3. [O14511-2]
RefSeq; NP_053585.1; NM_013982.2. [O14511-3]
RefSeq; NP_053586.1; NM_013983.2. [O14511-4]
RefSeq; XP_006714873.1; XM_006714810.3. [O14511-6]
UniGene; Hs.408515; -.
ProteinModelPortal; O14511; -.
SMR; O14511; -.
BioGrid; 114917; 2.
STRING; 9606.ENSP00000354910; -.
iPTMnet; O14511; -.
PhosphoSitePlus; O14511; -.
BioMuta; NRG2; -.
PaxDb; O14511; -.
PeptideAtlas; O14511; -.
PRIDE; O14511; -.
ProteomicsDB; 48047; -.
ProteomicsDB; 48048; -. [O14511-2]
ProteomicsDB; 48049; -. [O14511-3]
ProteomicsDB; 48050; -. [O14511-4]
ProteomicsDB; 48051; -. [O14511-5]
ProteomicsDB; 48052; -. [O14511-6]
ProteomicsDB; 48053; -. [O14511-7]
ProteomicsDB; 48054; -. [O14511-8]
DNASU; 9542; -.
Ensembl; ENST00000289409; ENSP00000289409; ENSG00000158458. [O14511-2]
Ensembl; ENST00000289422; ENSP00000289422; ENSG00000158458. [O14511-3]
Ensembl; ENST00000340391; ENSP00000342660; ENSG00000158458. [O14511-8]
Ensembl; ENST00000358522; ENSP00000351323; ENSG00000158458. [O14511-4]
Ensembl; ENST00000361474; ENSP00000354910; ENSG00000158458. [O14511-1]
Ensembl; ENST00000378238; ENSP00000367483; ENSG00000158458. [O14511-5]
GeneID; 9542; -.
KEGG; hsa:9542; -.
UCSC; uc003lev.3; human. [O14511-1]
CTD; 9542; -.
DisGeNET; 9542; -.
EuPathDB; HostDB:ENSG00000158458.19; -.
GeneCards; NRG2; -.
HGNC; HGNC:7998; NRG2.
HPA; HPA038935; -.
HPA; HPA047973; -.
MIM; 603818; gene.
neXtProt; NX_O14511; -.
OpenTargets; ENSG00000158458; -.
PharmGKB; PA31777; -.
eggNOG; ENOG410IGZW; Eukaryota.
eggNOG; ENOG410Y95Z; LUCA.
GeneTree; ENSGT00900000140940; -.
HOGENOM; HOG000273863; -.
HOVERGEN; HBG006531; -.
InParanoid; O14511; -.
KO; K05456; -.
OMA; ATEHVIR; -.
OrthoDB; EOG091G032E; -.
PhylomeDB; O14511; -.
TreeFam; TF332469; -.
Reactome; R-HSA-1227986; Signaling by ERBB2.
Reactome; R-HSA-1236394; Signaling by ERBB4.
Reactome; R-HSA-1250196; SHC1 events in ERBB2 signaling.
Reactome; R-HSA-1250342; PI3K events in ERBB4 signaling.
Reactome; R-HSA-1250347; SHC1 events in ERBB4 signaling.
Reactome; R-HSA-1251985; Nuclear signaling by ERBB4.
Reactome; R-HSA-1257604; PIP3 activates AKT signaling.
Reactome; R-HSA-1306955; GRB7 events in ERBB2 signaling.
Reactome; R-HSA-1358803; Downregulation of ERBB2:ERBB3 signaling.
Reactome; R-HSA-1963640; GRB2 events in ERBB2 signaling.
Reactome; R-HSA-1963642; PI3K events in ERBB2 signaling.
Reactome; R-HSA-2219530; Constitutive Signaling by Aberrant PI3K in Cancer.
Reactome; R-HSA-5673001; RAF/MAP kinase cascade.
Reactome; R-HSA-6785631; ERBB2 Regulates Cell Motility.
Reactome; R-HSA-6811558; PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling.
Reactome; R-HSA-8847993; ERBB2 Activates PTK6 Signaling.
Reactome; R-HSA-8863795; Downregulation of ERBB2 signaling.
SignaLink; O14511; -.
SIGNOR; O14511; -.
GeneWiki; NRG2; -.
GenomeRNAi; 9542; -.
PRO; PR:O14511; -.
Proteomes; UP000005640; Chromosome 5.
Bgee; ENSG00000158458; Expressed in 166 organ(s), highest expression level in cerebellar vermis.
CleanEx; HS_NRG2; -.
ExpressionAtlas; O14511; baseline and differential.
Genevisible; O14511; HS.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005622; C:intracellular; IEA:GOC.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0008083; F:growth factor activity; IEA:UniProtKB-KW.
GO; GO:0046934; F:phosphatidylinositol-4,5-bisphosphate 3-kinase activity; TAS:Reactome.
GO; GO:0004713; F:protein tyrosine kinase activity; TAS:Reactome.
GO; GO:0005088; F:Ras guanyl-nucleotide exchange factor activity; TAS:Reactome.
GO; GO:0005102; F:signaling receptor binding; TAS:ProtInc.
GO; GO:0048513; P:animal organ development; IBA:GO_Central.
GO; GO:0038128; P:ERBB2 signaling pathway; TAS:Reactome.
GO; GO:0035556; P:intracellular signal transduction; IBA:GO_Central.
GO; GO:0000165; P:MAPK cascade; TAS:Reactome.
GO; GO:0051897; P:positive regulation of protein kinase B signaling; TAS:Reactome.
GO; GO:2000145; P:regulation of cell motility; TAS:Reactome.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
Gene3D; 2.60.40.10; -; 1.
InterPro; IPR013032; EGF-like_CS.
InterPro; IPR000742; EGF-like_dom.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR013098; Ig_I-set.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
InterPro; IPR002154; Neuregulin_C.
Pfam; PF07679; I-set; 1.
Pfam; PF02158; Neuregulin; 1.
SMART; SM00409; IG; 1.
SMART; SM00408; IGc2; 1.
SUPFAM; SSF48726; SSF48726; 1.
PROSITE; PS00022; EGF_1; 1.
PROSITE; PS01186; EGF_2; 1.
PROSITE; PS50026; EGF_3; 1.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; EGF-like domain; Glycoprotein; Growth factor;
Immunoglobulin domain; Membrane; Reference proteome; Secreted;
Transmembrane; Transmembrane helix.
PROPEP 1 111 {ECO:0000250}.
/FTId=PRO_0000019472.
CHAIN 112 850 Pro-neuregulin-2, membrane-bound isoform.
/FTId=PRO_0000019473.
CHAIN 112 404 Neuregulin-2.
/FTId=PRO_0000019474.
TOPO_DOM 112 405 Extracellular. {ECO:0000255}.
TRANSMEM 406 426 Helical; Note=Internal signal sequence.
{ECO:0000255}.
TOPO_DOM 427 850 Cytoplasmic. {ECO:0000255}.
DOMAIN 237 332 Ig-like C2-type.
DOMAIN 341 382 EGF-like. {ECO:0000255|PROSITE-
ProRule:PRU00076}.
COMPBIAS 10 13 Poly-Pro.
COMPBIAS 20 30 Poly-Ser.
COMPBIAS 33 47 Poly-Ser.
COMPBIAS 87 90 Poly-Ala.
COMPBIAS 330 340 Ser/Thr-rich.
COMPBIAS 721 727 Poly-Pro.
CARBOHYD 52 52 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 53 53 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 147 147 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 278 278 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 346 346 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 257 311 {ECO:0000250}.
DISULFID 345 359 {ECO:0000250}.
DISULFID 353 370 {ECO:0000250}.
DISULFID 372 381 {ECO:0000250}.
VAR_SEQ 1 241 Missing (in isoform DON-1B).
{ECO:0000303|PubMed:9199335}.
/FTId=VSP_003452.
VAR_SEQ 1 233 MRQVCCSALPPPPLEKGRCSSYSDSSSSSSERSSSSSSSSS
ESGSSSRSSSNNSSISRPAAPPEPRPQQQPQPRSPAARRAA
ARSRAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQDQ
AYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVL
DKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPL
VFKTAFAPLDTNGKNLKKEVGKILCTDC -> MSESRRRGR
GRGKKHPEGRKREREPDPGEK (in isoform DON-
1R). {ECO:0000303|PubMed:9199335}.
/FTId=VSP_003451.
VAR_SEQ 374 397 NGFFGQRCLEKLPLRLYMPDPKQK -> VGYTGDRCQQFAM
VNFSKHLGFELKE (in isoform 4).
{ECO:0000305}.
/FTId=VSP_003454.
VAR_SEQ 374 396 NGFFGQRCLEKLPLRLYMPDPKQ -> VGYTGDRCQQFAMV
NFS (in isoform 2). {ECO:0000305}.
/FTId=VSP_003453.
VAR_SEQ 397 426 KAEELYQKRVLTITGICVALLVVGIVCVVA -> SVLWDTP
GTGVSSSQWSTSPKPRSCTRRGS (in isoform 5).
{ECO:0000305}.
/FTId=VSP_003458.
VAR_SEQ 397 422 KAEELYQKRVLTITGICVALLVVGIV -> SVLWDTPGTGV
SSSQWSTSPSTLDLN (in isoform 6).
{ECO:0000305}.
/FTId=VSP_003456.
VAR_SEQ 397 397 K -> KHLGFELKE (in isoform 3 and isoform
DON-1B). {ECO:0000303|PubMed:9199335}.
/FTId=VSP_003455.
VAR_SEQ 423 850 Missing (in isoform 6). {ECO:0000305}.
/FTId=VSP_003457.
VAR_SEQ 427 850 Missing (in isoform 5). {ECO:0000305}.
/FTId=VSP_003459.
SEQUENCE 850 AA; 91679 MW; 7124C089435FD2F4 CRC64;
MRQVCCSALP PPPLEKGRCS SYSDSSSSSS ERSSSSSSSS SESGSSSRSS SNNSSISRPA
APPEPRPQQQ PQPRSPAARR AAARSRAAAA GGMRRDPAPG FSMLLFGVSL ACYSPSLKSV
QDQAYKAPVV VEGKVQGLVP AGGSSSNSTR EPPASGRVAL VKVLDKWPLR SGGLQREQVI
SVGSCVPLER NQRYIFFLEP TEQPLVFKTA FAPLDTNGKN LKKEVGKILC TDCATRPKLK
KMKSQTGQVG EKQSLKCEAA AGNPQPSYRW FKDGKELNRS RDIRIKYGNG RKNSRLQFNK
VKVEDAGEYV CEAENILGKD TVRGRLYVNS VSTTLSSWSG HARKCNETAK SYCVNGGVCY
YIEGINQLSC KCPNGFFGQR CLEKLPLRLY MPDPKQKAEE LYQKRVLTIT GICVALLVVG
IVCVVAYCKT KKQRKQMHNH LRQNMCPAHQ NRSLANGPSH PRLDPEEIQM ADYISKNVPA
TDHVIRRETE TTFSGSHSCS PSHHCSTATP TSSHRHESHT WSLERSESLT SDSQSGIMLS
SVGTSKCNSP ACVEARARRA AAYNLEERRR ATAPPYHDSV DSLRDSPHSE RYVSALTTPA
RLSPVDFHYS LATQVPTFEI TSPNSAHAVS LPPAAPISYR LAEQQPLLRH PAPPGPGPGP
GPGPGPGADM QRSYDSYYYP AAGPGPRRGT CALGGSLGSL PASPFRIPED DEYETTQECA
PPPPPRPRAR GASRRTSAGP RRWRRSRLNG LAAQRARAAR DSLSLSSGSG GGSASASDDD
ADDADGALAA ESTPFLGLRG AHDALRSDSP PLCPAADSRT YYSLDSHSTR ASSRHSRGPP
PRAKQDSAPL


Related products :

Catalog number Product name Quantity
EIAAB27860 Nrg2,Ntak,Pro-neuregulin-2, membrane-bound isoform,Pro-NRG2,Rat,Rattus norvegicus
EIAAB27859 Homo sapiens,Human,NRG2,NTAK,Pro-neuregulin-2, membrane-bound isoform,Pro-NRG2
EIAAB27858 Mouse,Mus musculus,Nrg2,Pro-neuregulin-2, membrane-bound isoform,Pro-NRG2
CSB-EL016078RA Rat Pro-neuregulin-2, membrane-bound isoform(NRG2) ELISA kit SpeciesRat 96T
CSB-EL016078MO Mouse Pro-neuregulin-2, membrane-bound isoform(NRG2) ELISA kit SpeciesMouse 96T
CSB-EL016078HU Human Pro-neuregulin-2, membrane-bound isoform(NRG2) ELISA kit SpeciesHuman 96T
NRG2_RAT ELISA Kit FOR Pro-neuregulin-2, membrane-bound isoform; organism: Rat; gene name: Nrg2 96T
NRG2_MOUSE ELISA Kit FOR Pro-neuregulin-2, membrane-bound isoform; organism: Mouse; gene name: Nrg2 96T
NRG2_HUMAN ELISA Kit FOR Pro-neuregulin-2, membrane-bound isoform; organism: Human; gene name: NRG2 96T
E0661d Human ELISA Kit FOR Pro-neuregulin-3, membrane-bound isoform 96T
RHG30_MOUSE Human ELISA Kit FOR Pro-neuregulin-3, membrane-bound isoform 96T
CSB-EL016077RA Rat Pro-neuregulin-1, membrane-bound isoform(NRG1) ELISA kit SpeciesRat 96T
CSB-EL016079HU Human Pro-neuregulin-3, membrane-bound isoform(NRG3) ELISA kit SpeciesHuman 96T
E1866r ELISA Kit FOR Pro-neuregulin-1, membrane-bound isoform; organism: Rat; gene name: Nrg1 96T
CSB-EL016080HU Human Pro-neuregulin-4, membrane-bound isoform(NRG4) ELISA kit SpeciesHuman 96T
CSB-EL016077CH Chicken Pro-neuregulin-1, membrane-bound isoform(NRG1) ELISA kit SpeciesChicken 96T
CSB-EL016079MO Mouse Pro-neuregulin-3, membrane-bound isoform(NRG3) ELISA kit SpeciesMouse 96T
CSB-EL016080MO Mouse Pro-neuregulin-4, membrane-bound isoform(NRG4) ELISA kit SpeciesMouse 96T
NRG3_MOUSE ELISA Kit FOR Pro-neuregulin-3, membrane-bound isoform; organism: Mouse; gene name: Nrg3 96T
E1866h ELISA Kit FOR Pro-neuregulin-1, membrane-bound isoform; organism: Human; gene name: NRG1 96T
NRG4_HUMAN ELISA Kit FOR Pro-neuregulin-4, membrane-bound isoform; organism: Human; gene name: NRG4 96T
NRG4_MOUSE ELISA Kit FOR Pro-neuregulin-4, membrane-bound isoform; organism: Mouse; gene name: Nrg4 96T
NRG3_HUMAN ELISA Kit FOR Pro-neuregulin-3, membrane-bound isoform; organism: Human; gene name: NRG3 96T
EIAAB27864 Mouse,Mus musculus,Nrg4,Pro-neuregulin-4, membrane-bound isoform,Pro-NRG4
EIAAB27861 Mouse,Mus musculus,Nrg3,Pro-neuregulin-3, membrane-bound isoform,Pro-NRG3


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur