Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Probable cyclic nucleotide-gated ion channel 12 (Cyclic nucleotide- and calmodulin-regulated ion channel 12)

 CNG12_ARATH             Reviewed;         649 AA.
Q8GWD2; Q9SKD5;
21-NOV-2003, integrated into UniProtKB/Swiss-Prot.
21-NOV-2003, sequence version 2.
23-MAY-2018, entry version 133.
RecName: Full=Probable cyclic nucleotide-gated ion channel 12;
AltName: Full=Cyclic nucleotide- and calmodulin-regulated ion channel 12;
Name=CNGC12; OrderedLocusNames=At2g46450; ORFNames=F11C10.14;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617197; DOI=10.1038/45471;
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D.,
Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V.,
Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L.,
Moffat K.S., Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L.,
Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H.,
Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D.,
Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M.,
Venter J.C.;
"Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana.";
Nature 402:761-768(1999).
[2]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
STRAIN=cv. Columbia;
PubMed=11910074; DOI=10.1126/science.1071006;
Seki M., Narusaka M., Kamiya A., Ishida J., Satou M., Sakurai T.,
Nakajima M., Enju A., Akiyama K., Oono Y., Muramatsu M.,
Hayashizaki Y., Kawai J., Carninci P., Itoh M., Ishii Y., Arakawa T.,
Shibata K., Shinagawa A., Shinozaki K.;
"Functional annotation of a full-length Arabidopsis cDNA collection.";
Science 296:141-145(2002).
[4]
GENE FAMILY, AND NOMENCLATURE.
PubMed=11500563; DOI=10.1104/pp.126.4.1646;
Maeser P., Thomine S., Schroeder J.I., Ward J.M., Hirschi K., Sze H.,
Talke I.N., Amtmann A., Maathuis F.J.M., Sanders D., Harper J.F.,
Tchieu J., Gribskov M., Persans M.W., Salt D.E., Kim S.A.,
Guerinot M.L.;
"Phylogenetic relationships within cation transporter families of
Arabidopsis.";
Plant Physiol. 126:1646-1667(2001).
-!- FUNCTION: Probable cyclic nucleotide-gated ion channel.
-!- SUBUNIT: Homotetramer or heterotetramer. {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass
membrane protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q8GWD2-1; Sequence=Displayed;
Name=2;
IsoId=Q8GWD2-2; Sequence=VSP_008989, VSP_008990;
Note=May be due to a competing acceptor splice site. No
experimental confirmation available.;
-!- DOMAIN: The binding of calmodulin to the C-terminus might
interfere with cyclic nucleotide binding and thus channel
activation. {ECO:0000250}.
-!- SIMILARITY: Belongs to the cyclic nucleotide-gated cation channel
(TC 1.A.1.5) family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAD23055.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AC006526; AAD23055.1; ALT_SEQ; Genomic_DNA.
EMBL; CP002685; AEC10697.1; -; Genomic_DNA.
EMBL; CP002685; ANM62322.1; -; Genomic_DNA.
EMBL; AK118918; BAC43501.1; -; mRNA.
PIR; A84903; A84903.
RefSeq; NP_001324486.1; NM_001337192.1. [Q8GWD2-1]
RefSeq; NP_850454.5; NM_180123.6. [Q8GWD2-1]
UniGene; At.36508; -.
UniGene; At.50596; -.
ProteinModelPortal; Q8GWD2; -.
SMR; Q8GWD2; -.
STRING; 3702.AT2G46450.1; -.
PaxDb; Q8GWD2; -.
EnsemblPlants; AT2G46450.1; AT2G46450.1; AT2G46450. [Q8GWD2-1]
EnsemblPlants; AT2G46450.4; AT2G46450.4; AT2G46450. [Q8GWD2-1]
GeneID; 819253; -.
Gramene; AT2G46450.1; AT2G46450.1; AT2G46450. [Q8GWD2-1]
Gramene; AT2G46450.4; AT2G46450.4; AT2G46450. [Q8GWD2-1]
KEGG; ath:AT2G46450; -.
Araport; AT2G46450; -.
TAIR; locus:2039114; AT2G46450.
eggNOG; KOG0498; Eukaryota.
eggNOG; ENOG410XPSE; LUCA.
HOGENOM; HOG000238338; -.
InParanoid; Q8GWD2; -.
KO; K05391; -.
OMA; NENIPQG; -.
OrthoDB; EOG0936058Y; -.
PhylomeDB; Q8GWD2; -.
PRO; PR:Q8GWD2; -.
Proteomes; UP000006548; Chromosome 2.
ExpressionAtlas; Q8GWD2; differential.
Genevisible; Q8GWD2; AT.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; IDA:TAIR.
GO; GO:0005516; F:calmodulin binding; IEA:UniProtKB-KW.
GO; GO:0030552; F:cAMP binding; IEA:UniProtKB-KW.
GO; GO:0005261; F:cation channel activity; IMP:TAIR.
GO; GO:0030553; F:cGMP binding; IEA:UniProtKB-KW.
GO; GO:0005249; F:voltage-gated potassium channel activity; IBA:GO_Central.
GO; GO:0006952; P:defense response; IGI:TAIR.
GO; GO:0042391; P:regulation of membrane potential; IBA:GO_Central.
GO; GO:0009617; P:response to bacterium; IGI:TAIR.
GO; GO:0009620; P:response to fungus; IMP:TAIR.
CDD; cd00038; CAP_ED; 1.
Gene3D; 2.60.120.10; -; 1.
InterPro; IPR018490; cNMP-bd-like.
InterPro; IPR000595; cNMP-bd_dom.
InterPro; IPR005821; Ion_trans_dom.
InterPro; IPR000048; IQ_motif_EF-hand-BS.
InterPro; IPR014710; RmlC-like_jellyroll.
Pfam; PF00520; Ion_trans; 1.
SMART; SM00100; cNMP; 1.
SUPFAM; SSF51206; SSF51206; 1.
PROSITE; PS50042; CNMP_BINDING_3; 1.
PROSITE; PS50096; IQ; 1.
2: Evidence at transcript level;
Alternative splicing; Calmodulin-binding; cAMP; cAMP-binding;
Cell membrane; cGMP; cGMP-binding; Complete proteome; Ion channel;
Ion transport; Ligand-gated ion channel; Membrane; Nucleotide-binding;
Reference proteome; Transmembrane; Transmembrane helix; Transport.
CHAIN 1 649 Probable cyclic nucleotide-gated ion
channel 12.
/FTId=PRO_0000219340.
TOPO_DOM 1 43 Cytoplasmic. {ECO:0000255}.
TRANSMEM 44 64 Helical; Name=H1. {ECO:0000255}.
TOPO_DOM 65 76 Extracellular. {ECO:0000255}.
TRANSMEM 77 97 Helical; Name=H2. {ECO:0000255}.
TOPO_DOM 98 128 Cytoplasmic. {ECO:0000255}.
TRANSMEM 129 149 Helical; Name=H3. {ECO:0000255}.
TOPO_DOM 150 162 Extracellular. {ECO:0000255}.
TRANSMEM 163 183 Helical; Name=H4. {ECO:0000255}.
TOPO_DOM 184 200 Cytoplasmic. {ECO:0000255}.
TRANSMEM 201 221 Helical; Name=H5. {ECO:0000255}.
TOPO_DOM 222 329 Extracellular. {ECO:0000255}.
TRANSMEM 330 350 Helical; Name=H6. {ECO:0000255}.
TOPO_DOM 351 649 Cytoplasmic. {ECO:0000255}.
DOMAIN 565 594 IQ. {ECO:0000255|PROSITE-
ProRule:PRU00116}.
NP_BIND 436 559 cNMP.
REGION 545 560 Calmodulin-binding. {ECO:0000250}.
BINDING 507 507 cNMP. {ECO:0000250}.
VAR_SEQ 316 368 SALGQNLETSNSAGEIFFAIIICVSGLLLFAVLIGNVQKYL
QSSTTRVDEMEE -> RLIHSTVLWAKTWRQATLQGRFSLL
SSYVSLVYSCLLCSLETFRSTCNHLLLE (in isoform
2). {ECO:0000303|PubMed:11910074}.
/FTId=VSP_008989.
VAR_SEQ 369 649 Missing (in isoform 2).
{ECO:0000303|PubMed:11910074}.
/FTId=VSP_008990.
SEQUENCE 649 AA; 74806 MW; 0737B9857B6C4EBB CRC64;
MNHRRSKFAR IDSMGVDGKL KSVRGRLKKV YGKMKTLENW RKTVLLACVV ALAIDPLFLF
IPLIDSQRFC FTFDKTLVAV VCVIRTFIDT FYVIHIIYYL ITETIAPRSQ ASLRGEIVVH
SKATLKTRLL FHFIVDIISV LPIPQVVVLT LIPLSASLVS ERILKWIILS QYVPRIIRMY
PLYKEVTRAF GTVAESKWAG AALNLFLYML HSYVFGAFWY LSSIERKSKC WRAACARTSD
CNLTVTDLLC KRAGSDNIRF LNTSCPLIDP AQITNSTDFD FGMYIDALKS GVLEVKPKDF
PRKFVYCFWW GLRNISALGQ NLETSNSAGE IFFAIIICVS GLLLFAVLIG NVQKYLQSST
TRVDEMEEKR RDTEKWMSYR VIPEYLKERI RRFEDYKWRE TKGTEEEALL RSLPKDLRLE
TKRYLYLDML KRVPWLNIMD DGWLLEAVCD RVKSVFYLAN SFIVREGHPV EEMLIVTRGK
LKSTTGSHEM GVRNNCCDLQ DGDICGELLF NGSRLPTSTR TVMTLTEVEG FILLPDDIKF
IASHLNVFQR QKLQRTFRLY SQQWRSWAAF FIQAAWRKHC KRKLSKTRDN ENIPQGTQLN
LASTLYVSRF VSKALQNRRK DTADCSSSPD MSPPVPHKPA DLEFAKAEA


Related products :

Catalog number Product name Quantity
EIAAB08175 CNCA,CNCA1,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Homo sapiens,Human
EIAAB08177 Aorta CNG channel,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Oryctolagus cuni
EIAAB08174 Cncg2,Cncg4,CNG channel alpha-2,CNG2,CNG-2,Cnga2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Mouse,Mus musculus
EIAAB08182 Cgn2,CNG channel alpha-4,CNG4,CNG-4,Cnga4,Cyclic nucleotide-gated cation channel alpha-4,Cyclic nucleotide-gated channel alpha-4,Cyclic nucleotide-gated olfactory channel subunit OCNC2,Rat,Rattus norv
EIAAB08178 Bos taurus,Bovine,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel
EIAAB08176 Cncg2,CNG channel alpha-2,CNG2,CNG-2,Cnga2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Cyclic nucleotide-gated olfactory
EIAAB08172 cGMP-gated cation channel alpha-1,Cncg,Cncg1,CNG channel alpha-1,CNG1,CNG-1,Cnga1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-gated channel, phot
EIAAB08169 cGMP-gated cation channel alpha-1,CNCG,CNCG1,CNG channel alpha-1,CNG1,CNG-1,CNGA1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-gated channel, phot
EIAAB08171 cGMP-gated cation channel alpha-1,Cncg,Cncg1,CNG channel alpha-1,CNG1,CNG-1,Cnga1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-gated channel, phot
EIAAB08173 Bos taurus,Bovine,cGMP-gated cation channel alpha-1,CNCG,CNCG1,CNG channel alpha-1,CNG1,CNG-1,CNGA1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha-1,Cyclic nucleotide-g
EIAAB08186 CNCG2,CNCG3L,CNCG4,CNG channel 4,CNG channel beta-1,CNG4,CNG-4,CNGB1,Cyclic nucleotide-gated cation channel 4,Cyclic nucleotide-gated cation channel beta-1,Cyclic nucleotide-gated cation channel gamma
EIAAB08185 240 kDa protein of rod photoreceptor CNG-channel,Bos taurus,Bovine,CNCG4,CNG channel 4,CNG channel beta-1,CNG4,CNG-4,CNGB1,Cyclic nucleotide-gated cation channel 4,Cyclic nucleotide-gated cation chann
EIAAB08181 CNCG3,CNG channel alpha-3,CNG3,CNG-3,CNGA3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3,Homo sapiens,Human
EIAAB08179 Bos taurus,Bovine,CNCG3,CNG channel alpha-3,CNG3,CNG-3,CNGA3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3
EIAAB08188 CNG channel beta-3,CNGB3,Cone photoreceptor cGMP-gated channel subunit beta,Cyclic nucleotide-gated cation channel beta-3,Cyclic nucleotide-gated cation channel modulatory subunit,Cyclic nucleotide-ga
EIAAB08189 CNG channel beta-3,Cng6,Cngb3,Cone photoreceptor cGMP-gated channel subunit beta,Cyclic nucleotide-gated cation channel beta-3,Cyclic nucleotide-gated cation channel modulatory subunit,Cyclic nucleoti
EIAAB08180 CNG channel alpha-3,CNG3,Cng3,CNG-3,Cnga3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3,Mouse,Mus musculus
EIAAB08183 CNG channel alpha-4,CNG4,CNG-4,CNGA4,Cyclic nucleotide-gated cation channel alpha-4,Cyclic nucleotide-gated channel alpha-4,Homo sapiens,Human
EIAAB08184 CNG channel alpha-4,CNG4,CNG-4,Cnga4,Cyclic nucleotide-gated cation channel alpha-4,Cyclic nucleotide-gated channel alpha-4,Mouse,Mus musculus
EIAAB08187 Canis familiaris,Canis lupus familiaris,CNG channel beta-3,CNGB3,Cone photoreceptor cGMP-gated channel subunit beta,Cyclic nucleotide-gated cation channel beta-3,Cyclic nucleotide-gated cation channel
EIAAB08170 Canis familiaris,Canis lupus familiaris,cGMP-gated cation channel alpha-1,CNCG,CNCG1,CNG channel alpha-1,CNG1,CNG-1,CNGA1,Cyclic nucleotide-gated cation channel 1,Cyclic nucleotide-gated channel alpha
11508 HCN3 Cyclic nucleotide-gated Channel 100ug
11509 HCN4 Cyclic nucleotide-gated Channel 100ug
11507 HCN2 Cyclic nucleotide-gated Channel 100ug
11506 HCN1 Cyclic nucleotide-gated Channel 100ug


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur