Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Proprotein convertase subtilisin/kexin type 6 (EC 3.4.21.-) (Paired basic amino acid cleaving enzyme 4) (Subtilisin-like proprotein convertase 4) (SPC4) (Subtilisin/kexin-like protease PACE4)

 PCSK6_HUMAN             Reviewed;         969 AA.
P29122; Q15099; Q15100; Q9UEG7; Q9UEJ1; Q9UEJ2; Q9UEJ7; Q9UEJ8;
Q9UEJ9; Q9Y4G9; Q9Y4H0; Q9Y4H1;
01-DEC-1992, integrated into UniProtKB/Swiss-Prot.
01-DEC-1992, sequence version 1.
22-NOV-2017, entry version 181.
RecName: Full=Proprotein convertase subtilisin/kexin type 6;
EC=3.4.21.-;
AltName: Full=Paired basic amino acid cleaving enzyme 4;
AltName: Full=Subtilisin-like proprotein convertase 4;
Short=SPC4;
AltName: Full=Subtilisin/kexin-like protease PACE4;
Flags: Precursor;
Name=PCSK6; Synonyms=PACE4;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4A-I AND PACE4B).
TISSUE=Hepatoma, and Kidney;
PubMed=1741956; DOI=10.1089/dna.1991.10.757;
Kiefer M.C., Tucker J.E., Joh R., Landsberg K.E., Saltman D.,
Barr P.J.;
"Identification of a second human subtilisin-like protease gene in the
fes/fps region of chromosome 15.";
DNA Cell Biol. 10:757-769(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4C AND PACE4D).
TISSUE=Placenta;
PubMed=8179631; DOI=10.1006/bbrc.1994.1541;
Tsuji A., Higashine K., Hine C., Mori K., Tamai Y., Nagamune H.,
Matsuda Y.;
"Identification of novel cDNAs encoding human kexin-like protease,
PACE4 isoforms.";
Biochem. Biophys. Res. Commun. 200:943-950(1994).
[3]
ERRATUM.
PubMed=7980617; DOI=10.1006/bbrc.1994.2616;
Tsuji A., Higashine K., Hine C., Mori K., Tamai Y., Nagamune H.,
Matsuda Y.;
Biochem. Biophys. Res. Commun. 204:1381-1382(1994).
[4]
NUCLEOTIDE SEQUENCE (ISOFORM PACE4A-II).
TISSUE=Placenta;
Mori K., Imamaki A., Kii S., Nagamune H., Nagahama M., Tsuji A.,
Matsuda Y.;
"Identification of a novel PACE4 isoform, PACE4E.";
Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS PACE4E-I AND PACE4E-II).
TISSUE=Cerebellum;
PubMed=9192737; DOI=10.1093/oxfordjournals.jbchem.a021677;
Mori K., Kii S., Tsuji A., Nagahama M., Imamaki A., Hayashi K.,
Akamatsu T., Nagamune H., Matsuda Y.;
"A novel human PACE4 isoform, PACE4E is an active processing protease
containing a hydrophobic cluster at the carboxy terminus.";
J. Biochem. 121:941-948(1997).
[6]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS PACE4A-I; PACE4A-II;
PACE4CS; PACE4D; PACE4E-I AND PACE4E-II).
PubMed=9378725; DOI=10.1093/oxfordjournals.jbchem.a021772;
Tsuji A., Hine C., Tamai Y., Yonemoto K., Mori K., Yoshida S.,
Bando M., Sakai E., Mori K., Akamatsu T., Matsuda Y.;
"Genomic organization and alternative splicing of human PACE4 (SPC4),
kexin-like processing endoprotease.";
J. Biochem. 122:438-452(1997).
[7]
ALTERNATIVE SPLICING (ISOFORM PACE4CS).
PubMed=8906861; DOI=10.1016/0014-5793(96)01059-9;
Zhong M., Benjannet S., Lazure C., Munzer S., Seidah N.G.;
"Functional analysis of human PACE4-A and PACE4-C isoforms:
identification of a new PACE4-CS isoform.";
FEBS Lett. 396:31-36(1996).
[8]
CHARACTERIZATION.
PubMed=10215603; DOI=10.1042/bj3390639;
Sucic J.F., Moehring J.M., Inocencio N.M., Luchini J.W.,
Moehring T.J.;
"Endoprotease PACE4 is Ca2+-dependent and temperature-sensitive and
can partly rescue the phenotype of a furin-deficient cell strain.";
Biochem. J. 339:639-647(1999).
[9]
PROTEOLYTIC PROCESSING.
PubMed=9738469; DOI=10.1016/S0014-5793(98)00970-3;
Nagahama M., Taniguchi T., Hashimoto E., Imamaki A., Mori K.,
Tsuji A., Matsuda Y.;
"Biosynthetic processing and quaternary interactions of proprotein
convertase SPC4 (PACE4).";
FEBS Lett. 434:155-159(1998).
-!- FUNCTION: Serine endoprotease that processes various proproteins
by cleavage at paired basic amino acids, recognizing the RXXX[KR]R
consensus motif. Likely functions in the constitutive secretory
pathway, with unique restricted distribution in both
neuroendocrine and non-neuroendocrine tissues.
-!- COFACTOR:
Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000305};
-!- SUBUNIT: The PACE4A-I precursor protein seems to exist in the
reticulum endoplasmic as both a monomer and a dimer-sized complex
whereas mature PACE4A-I exists only as a monomer, suggesting that
propeptide cleavage affects its tertiary or quaternary structure.
-!- SUBCELLULAR LOCATION: Isoform PACE4A-I: Secreted.
-!- SUBCELLULAR LOCATION: Isoform PACE4A-II: Secreted.
-!- SUBCELLULAR LOCATION: Isoform PACE4C: Endoplasmic reticulum.
Note=Not secreted, remains probably in zymogen form in endoplasmic
reticulum.
-!- SUBCELLULAR LOCATION: Isoform PACE4CS: Endoplasmic reticulum.
Note=Not secreted, remains probably in zymogen form in endoplasmic
reticulum.
-!- SUBCELLULAR LOCATION: Isoform PACE4E-I: Endomembrane system;
Peripheral membrane protein. Note=Retained intracellularly
probably through a hydrophobic cluster in their C-terminus.
-!- SUBCELLULAR LOCATION: Isoform PACE4E-II: Endomembrane system;
Peripheral membrane protein. Note=Retained intracellularly
probably through a hydrophobic cluster in their C-terminus.
-!- SUBCELLULAR LOCATION: Isoform PACE4B: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=PACE4A-I; Synonyms=PACE4;
IsoId=P29122-1; Sequence=Displayed;
Name=PACE4A-II;
IsoId=P29122-2; Sequence=VSP_005436;
Name=PACE4B; Synonyms=PACE4.1;
IsoId=P29122-3; Sequence=VSP_005428, VSP_005429;
Note=Probably enzymatically inactive.;
Name=PACE4C;
IsoId=P29122-4; Sequence=VSP_005432, VSP_005433;
Note=Probably enzymatically inactive.;
Name=PACE4CS;
IsoId=P29122-5; Sequence=VSP_005430, VSP_005431;
Note=Probably enzymatically inactive.;
Name=PACE4D;
IsoId=P29122-6; Sequence=VSP_005427, VSP_005434, VSP_005435;
Note=Probably enzymatically inactive.;
Name=PACE4E-I;
IsoId=P29122-7; Sequence=VSP_005437;
Name=PACE4E-II;
IsoId=P29122-8; Sequence=VSP_005436, VSP_005437;
-!- TISSUE SPECIFICITY: Each PACE4 isoform exhibits a unique
restricted distribution. Isoform PACE4A-I is expressed in heart,
brain, placenta, lung, skeletal muscle, kidney, pancreas, but at
comparatively higher levels in the liver. Isoform PACE4A-II is at
least expressed in placenta. Isoform PACE4B was only found in the
embryonic kidney cell line from which it was isolated. Isoform
PACE4C and isoform PACE4D are expressed in placenta. Isoform
PACE4E-I is expressed in cerebellum, placenta and pituitary.
Isoform PACE4E-II is at least present in cerebellum.
-!- DOMAIN: The propeptide domain acts as an intramolecular chaperone
assisting the folding of the zymogen within the endoplasmic
reticulum. Isoform PACE4D lacks the propeptide domain.
-!- SIMILARITY: Belongs to the peptidase S8 family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M80482; AAA59998.1; -; mRNA.
EMBL; AB001914; BAA21620.1; -; Genomic_DNA.
EMBL; AB001914; BAA21621.1; -; Genomic_DNA.
EMBL; AB001914; BAA21622.1; -; Genomic_DNA.
EMBL; AB001914; BAA21623.1; -; Genomic_DNA.
EMBL; AB001914; BAA21624.1; -; Genomic_DNA.
EMBL; AB001914; BAA21625.1; -; Genomic_DNA.
EMBL; AB001914; BAA21626.1; -; Genomic_DNA.
EMBL; AB001914; BAA21627.1; -; Genomic_DNA.
EMBL; D28513; BAA05871.1; -; mRNA.
EMBL; D28514; BAA05872.1; -; mRNA.
EMBL; D87995; BAA21793.1; -; mRNA.
EMBL; D87993; BAA21791.1; -; mRNA.
EMBL; D87994; BAA21792.1; -; mRNA.
CCDS; CCDS73789.1; -. [P29122-2]
CCDS; CCDS73790.1; -. [P29122-1]
CCDS; CCDS73791.1; -. [P29122-5]
CCDS; CCDS73793.1; -. [P29122-4]
PIR; A39490; A39490.
PIR; B39490; B39490.
PIR; JC2191; JC2191.
PIR; JC2192; JC2192.
PIR; JC5570; JC5570.
PIR; JC5571; JC5571.
RefSeq; NP_001278238.1; NM_001291309.1.
RefSeq; NP_002561.1; NM_002570.4. [P29122-1]
RefSeq; NP_612192.1; NM_138319.3. [P29122-2]
RefSeq; NP_612195.1; NM_138322.3. [P29122-3]
RefSeq; NP_612196.1; NM_138323.2. [P29122-5]
RefSeq; NP_612197.1; NM_138324.2. [P29122-4]
RefSeq; NP_612198.2; NM_138325.3.
UniGene; Hs.498494; -.
UniGene; Hs.665989; -.
ProteinModelPortal; P29122; -.
SMR; P29122; -.
BioGrid; 111083; 5.
DIP; DIP-29903N; -.
IntAct; P29122; 5.
MINT; MINT-3011239; -.
STRING; 9606.ENSP00000305056; -.
BindingDB; P29122; -.
ChEMBL; CHEMBL2951; -.
GuidetoPHARMACOLOGY; 2386; -.
MEROPS; S08.075; -.
iPTMnet; P29122; -.
PhosphoSitePlus; P29122; -.
BioMuta; PCSK6; -.
DMDM; 129542; -.
MaxQB; P29122; -.
PaxDb; P29122; -.
PeptideAtlas; P29122; -.
PRIDE; P29122; -.
TopDownProteomics; P29122-3; -. [P29122-3]
Ensembl; ENST00000611716; ENSP00000482760; ENSG00000140479. [P29122-1]
Ensembl; ENST00000611967; ENSP00000477768; ENSG00000140479. [P29122-4]
Ensembl; ENST00000615296; ENSP00000478081; ENSG00000140479. [P29122-5]
Ensembl; ENST00000618548; ENSP00000479496; ENSG00000140479. [P29122-2]
GeneID; 5046; -.
KEGG; hsa:5046; -.
UCSC; uc032csi.2; human. [P29122-1]
CTD; 5046; -.
DisGeNET; 5046; -.
EuPathDB; HostDB:ENSG00000140479.16; -.
GeneCards; PCSK6; -.
HGNC; HGNC:8569; PCSK6.
HPA; HPA004774; -.
MIM; 167405; gene.
neXtProt; NX_P29122; -.
OpenTargets; ENSG00000140479; -.
PharmGKB; PA32895; -.
eggNOG; KOG3525; Eukaryota.
eggNOG; COG1404; LUCA.
eggNOG; COG4935; LUCA.
GeneTree; ENSGT00750000117358; -.
HOVERGEN; HBG008705; -.
InParanoid; P29122; -.
KO; K08672; -.
PhylomeDB; P29122; -.
TreeFam; TF314277; -.
BRENDA; 3.4.21.B25; 2681.
Reactome; R-HSA-1181150; Signaling by NODAL.
Reactome; R-HSA-167060; NGF processing.
Reactome; R-HSA-6809371; Formation of the cornified envelope.
Reactome; R-HSA-8963889; Assembly of active LPL and LIPC lipase complexes.
SignaLink; P29122; -.
ChiTaRS; PCSK6; human.
GeneWiki; PCSK6; -.
GenomeRNAi; 5046; -.
PRO; PR:P29122; -.
Proteomes; UP000005640; Chromosome 15.
Bgee; ENSG00000140479; -.
ExpressionAtlas; P29122; baseline and differential.
Genevisible; P29122; HS.
GO; GO:0009986; C:cell surface; IDA:BHF-UCL.
GO; GO:0005783; C:endoplasmic reticulum; IEA:UniProtKB-SubCell.
GO; GO:0031012; C:extracellular matrix; IDA:BHF-UCL.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IDA:BHF-UCL.
GO; GO:0005796; C:Golgi lumen; TAS:Reactome.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0004175; F:endopeptidase activity; IDA:BHF-UCL.
GO; GO:0008201; F:heparin binding; IDA:BHF-UCL.
GO; GO:0048406; F:nerve growth factor binding; IDA:BHF-UCL.
GO; GO:0004252; F:serine-type endopeptidase activity; IDA:BHF-UCL.
GO; GO:0070268; P:cornification; TAS:Reactome.
GO; GO:0007368; P:determination of left/right symmetry; IEA:Ensembl.
GO; GO:0009100; P:glycoprotein metabolic process; IDA:BHF-UCL.
GO; GO:0032455; P:nerve growth factor processing; TAS:Reactome.
GO; GO:0032902; P:nerve growth factor production; IDA:BHF-UCL.
GO; GO:0016486; P:peptide hormone processing; IDA:BHF-UCL.
GO; GO:0016485; P:protein processing; IDA:BHF-UCL.
GO; GO:0030510; P:regulation of BMP signaling pathway; TAS:BHF-UCL.
GO; GO:0051004; P:regulation of lipoprotein lipase activity; TAS:Reactome.
GO; GO:0032940; P:secretion by cell; IDA:BHF-UCL.
GO; GO:0007354; P:zygotic determination of anterior/posterior axis, embryo; IEA:Ensembl.
CDD; cd04059; Peptidases_S8_Protein_converta; 1.
Gene3D; 2.60.120.260; -; 1.
Gene3D; 3.40.50.200; -; 1.
InterPro; IPR000742; EGF-like_dom.
InterPro; IPR006212; Furin_repeat.
InterPro; IPR008979; Galactose-bd-like_sf.
InterPro; IPR032778; GF_recep_IV.
InterPro; IPR009030; Growth_fac_rcpt_cys_sf.
InterPro; IPR034182; Kexin/furin.
InterPro; IPR009020; Peptidase/Inhibitor_I9.
InterPro; IPR000209; Peptidase_S8/S53_dom.
InterPro; IPR036852; Peptidase_S8/S53_dom_sf.
InterPro; IPR023827; Peptidase_S8_Asp-AS.
InterPro; IPR022398; Peptidase_S8_His-AS.
InterPro; IPR023828; Peptidase_S8_Ser-AS.
InterPro; IPR015500; Peptidase_S8_subtilisin-rel.
InterPro; IPR010909; PLAC.
InterPro; IPR002884; PrprotnconvertsP.
InterPro; IPR032815; S8_pro-domain.
Pfam; PF14843; GF_recep_IV; 1.
Pfam; PF01483; P_proprotein; 1.
Pfam; PF00082; Peptidase_S8; 1.
Pfam; PF08686; PLAC; 1.
Pfam; PF16470; S8_pro-domain; 1.
PRINTS; PR00723; SUBTILISIN.
SMART; SM00181; EGF; 5.
SMART; SM00261; FU; 5.
SUPFAM; SSF49785; SSF49785; 1.
SUPFAM; SSF52743; SSF52743; 1.
SUPFAM; SSF54897; SSF54897; 1.
SUPFAM; SSF57184; SSF57184; 2.
PROSITE; PS51829; P_HOMO_B; 1.
PROSITE; PS50900; PLAC; 1.
PROSITE; PS00136; SUBTILASE_ASP; 1.
PROSITE; PS00137; SUBTILASE_HIS; 1.
PROSITE; PS00138; SUBTILASE_SER; 1.
1: Evidence at protein level;
Alternative splicing; Calcium; Cleavage on pair of basic residues;
Complete proteome; Endoplasmic reticulum; Glycoprotein; Hydrolase;
Membrane; Polymorphism; Protease; Reference proteome; Repeat;
Secreted; Serine protease; Signal; Zymogen.
SIGNAL 1 63 {ECO:0000255}.
PROPEP 64 149 {ECO:0000269|PubMed:9738469}.
/FTId=PRO_0000027110.
CHAIN 150 969 Proprotein convertase subtilisin/kexin
type 6.
/FTId=PRO_0000027111.
DOMAIN 200 487 Peptidase S8.
DOMAIN 495 635 P/Homo B. {ECO:0000255|PROSITE-
ProRule:PRU01173}.
REPEAT 692 739 FU 1.
REPEAT 743 790 FU 2.
REPEAT 794 838 FU 3.
REPEAT 842 887 FU 4.
REPEAT 895 943 FU 5.
DOMAIN 931 969 PLAC. {ECO:0000255|PROSITE-
ProRule:PRU00233}.
REGION 695 930 CRM (Cys-rich motif).
MOTIF 553 555 Cell attachment site. {ECO:0000255}.
ACT_SITE 205 205 Charge relay system. {ECO:0000250}.
ACT_SITE 246 246 Charge relay system. {ECO:0000250}.
ACT_SITE 420 420 Charge relay system. {ECO:0000250}.
SITE 149 150 Cleavage; by autolysis.
{ECO:0000269|PubMed:9738469}.
CARBOHYD 259 259 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 914 914 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 932 932 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 167 Missing (in isoform PACE4D).
{ECO:0000303|PubMed:8179631}.
/FTId=VSP_005427.
VAR_SEQ 471 471 K -> KGAAVAFWWTIGWPWNV (in isoform
PACE4B). {ECO:0000303|PubMed:1741956}.
/FTId=VSP_005428.
VAR_SEQ 472 969 Missing (in isoform PACE4B).
{ECO:0000303|PubMed:1741956}.
/FTId=VSP_005429.
VAR_SEQ 621 664 KLKEWSLILYGTAEHPYHTFSAHQSRSRMLELSAPELEPPK
AAL -> DLETPVANQLTTEERFVSTPSILFHWSVYLSWSQ
YHIVLITVAL (in isoform PACE4D).
{ECO:0000303|PubMed:8179631}.
/FTId=VSP_005434.
VAR_SEQ 621 652 KLKEWSLILYGTAEHPYHTFSAHQSRSRMLEL -> DLETP
VANQLTTEEREPGLKHVFRWQIEQELW (in isoform
PACE4C). {ECO:0000303|PubMed:8179631}.
/FTId=VSP_005432.
VAR_SEQ 621 623 KLK -> NLD (in isoform PACE4CS).
{ECO:0000305}.
/FTId=VSP_005430.
VAR_SEQ 624 969 Missing (in isoform PACE4CS).
{ECO:0000305}.
/FTId=VSP_005431.
VAR_SEQ 653 969 Missing (in isoform PACE4C).
{ECO:0000303|PubMed:8179631}.
/FTId=VSP_005433.
VAR_SEQ 665 969 Missing (in isoform PACE4D).
{ECO:0000303|PubMed:8179631}.
/FTId=VSP_005435.
VAR_SEQ 680 693 AQSTPGSANILQTS -> G (in isoform PACE4A-II
and isoform PACE4E-II).
{ECO:0000303|PubMed:9192737}.
/FTId=VSP_005436.
VAR_SEQ 901 969 CDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNADET
FCEMVKSNRLCERKLFIQFCCRTCLLAG -> YGPPGGERQ
ATVSSKGVPGGQSLSASSPGAGEGMLHHPTVDRSPFTELLR
GLRPFVHWMHICWVPAVGRHRAAAG (in isoform
PACE4E-I and isoform PACE4E-II).
{ECO:0000303|PubMed:9192737}.
/FTId=VSP_005437.
VARIANT 502 502 C -> R (in dbSNP:rs1058260).
/FTId=VAR_051824.
CONFLICT 639 639 T -> I (in Ref. 6; BAA21624/BAA21625/
BAA21626/BAA21627). {ECO:0000305}.
SEQUENCE 969 AA; 106420 MW; A3599CC278D09B05 CRC64;
MPPRAPPAPG PRPPPRAAAA TDTAAGAGGA GGAGGAGGPG FRPLAPRPWR WLLLLALPAA
CSAPPPRPVY TNHWAVQVLG GPAEADRVAA AHGYLNLGQI GNLEDYYHFY HSKTFKRSTL
SSRGPHTFLR MDPQVKWLQQ QEVKRRVKRQ VRSDPQALYF NDPIWSNMWY LHCGDKNSRC
RSEMNVQAAW KRGYTGKNVV VTILDDGIER NHPDLAPNYD SYASYDVNGN DYDPSPRYDA
SNENKHGTRC AGEVAASANN SYCIVGIAYN AKIGGIRMLD GDVTDVVEAK SLGIRPNYID
IYSASWGPDD DGKTVDGPGR LAKQAFEYGI KKGRQGLGSI FVWASGNGGR EGDYCSCDGY
TNSIYTISVS SATENGYKPW YLEECASTLA TTYSSGAFYE RKIVTTDLRQ RCTDGHTGTS
VSAPMVAGII ALALEANSQL TWRDVQHLLV KTSRPAHLKA SDWKVNGAGH KVSHFYGFGL
VDAEALVVEA KKWTAVPSQH MCVAASDKRP RSIPLVQVLR TTALTSACAE HSDQRVVYLE
HVVVRTSISH PRRGDLQIYL VSPSGTKSQL LAKRLLDLSN EGFTNWEFMT VHCWGEKAEG
QWTLEIQDLP SQVRNPEKQG KLKEWSLILY GTAEHPYHTF SAHQSRSRML ELSAPELEPP
KAALSPSQVE VPEDEEDYTA QSTPGSANIL QTSVCHPECG DKGCDGPNAD QCLNCVHFSL
GSVKTSRKCV SVCPLGYFGD TAARRCRRCH KGCETCSSRA ATQCLSCRRG FYHHQEMNTC
VTLCPAGFYA DESQKNCLKC HPSCKKCVDE PEKCTVCKEG FSLARGSCIP DCEPGTYFDS
ELIRCGECHH TCGTCVGPGR EECIHCAKNF HFHDWKCVPA CGEGFYPEEM PGLPHKVCRR
CDENCLSCAG SSRNCSRCKT GFTQLGTSCI TNHTCSNADE TFCEMVKSNR LCERKLFIQF
CCRTCLLAG


Related products :

Catalog number Product name Quantity
EIAAB30207 Homo sapiens,Human,PACE4,Paired basic amino acid cleaving enzyme 4,PCSK6,Proprotein convertase subtilisin_kexin type 6,SPC4,Subtilisin_kexin-like protease PACE4,Subtilisin-like proprotein convertase 4
EIAAB30208 Pace4,Paired basic amino acid cleaving enzyme 4,Pcsk6,Proprotein convertase subtilisin_kexin type 6,Rat,Rattus norvegicus,SPC4,Subtilisin_kexin-like protease PACE4,Subtilisin-like proprotein convertas
Y051641 Anti-PC9 paired basic amino acid cleaving enzyme-9 PCSK9 proprotein convertase subtilisin per kexin type 9a NARC-1 neural apoptosis regulated convertase 1; CT domain antibody 250ug
Y051640 Anti-PC9 paired basic amino acid cleaving enzyme-9 PCSK9 proprotein convertase subtilisin per kexin type 9a NARC-1 neural apoptosis regulated convertase 1; Propeptide domain antibody 250ug
EIAAB30205 Mouse,Mus musculus,PC5,PC6,Pcsk5,Proprotein convertase 5,Proprotein convertase 6,Proprotein convertase subtilisin_kexin type 5,SPC6,Subtilisin_kexin-like protease PC5,Subtilisin-like proprotein conver
CA83 PCSK-9, Proprotein Convertase Subtilisin Kexin Type 9 lmg
EGP040 Proprotein Convertase Subtilisin per Kexin Type 9 Elisa Kit 96T
C250 Proprotein Convertase Subtilisin Kexin Type 9 PCSK9 lmg
C249 Proprotein Convertase Subtilisin Kexin Type 9 Pcsk9 lmg
EH251 Proprotein convertase subtilisin per kexin type 9 Elisa Kit 96T
CA83 PCSK-9, Proprotein Convertase Subtilisin Kexin Type 9 500
C250 Proprotein Convertase Subtilisin Kexin Type 9 PCSK9 500
E1690d Rat ELISA Kit FOR Proprotein convertase subtilisin per kexin type 4 96T
EM153 Proprotein convertase subtilisin per kexin type 9 Elisa Kit 96T
ER134 Proprotein convertase subtilisin per kexin type 9 Elisa Kit 96T
C249 Proprotein Convertase Subtilisin Kexin Type 9 Pcsk9 500
E02P0136 Rat Proprotein Convertase Subtilisin Kexin Type 9 ELISA 96T/kit
C298 Human PCSK-9, Proprotein Convertase Subtilisin Kexin Type 9 l0
C250 Human Proprotein Convertase Subtilisin Kexin Type 9 Pcsk9 l0
UB-E10518 Rat Proprotein Convertase Subtilisin per Kexin Type 5(PCSK5)ELISA kit 96T
E12411634 Rat Proprotein Convertase Subtilisin per Kexin Type 1 (PCSK1) ELISA Kit 1
CG88 Human PCSK-9, Proprotein Convertase Subtilisin Kexin Type 9 50
C248 Human Proprotein Convertase Subtilisin Kexin Type 9 PCSK9 l0
CSB-EL017647RA Rat Proprotein convertase subtilisin per kexin type 9(PCSK9) ELISA kit 96T
E14P0136 Sheep Proprotein Convertase Subtilisin Kexin Type 9 ELISA 96T/kit


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur