Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Prostaglandin F2-alpha receptor (PGF receptor) (PGF2-alpha receptor) (Prostanoid FP receptor)

 PF2R_HUMAN              Reviewed;         359 AA.
P43088; A8K9Y0; Q2KHP3; Q6RYQ6; Q9P1X4;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
01-NOV-1995, sequence version 1.
31-JAN-2018, entry version 161.
RecName: Full=Prostaglandin F2-alpha receptor;
Short=PGF receptor;
Short=PGF2-alpha receptor;
AltName: Full=Prostanoid FP receptor;
Name=PTGFR;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Uterus;
PubMed=8300593;
Abramovitz M., Boie Y., Nguyen T., Rushmore T.H., Bayne M.A.,
Metters K.M., Slipetz D.M., Grygorczyk R.;
"Cloning and expression of a cDNA for the human prostanoid FP
receptor.";
J. Biol. Chem. 269:2632-2636(1994).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Ocular ciliary body;
PubMed=9341156; DOI=10.1074/jbc.272.43.27147;
Kunapuli P., Lawson J.A., Rokach J., FitzGerald G.A.;
"Functional characterization of the ocular prostaglandin f2alpha
(PGF2alpha) receptor. Activation by the isoprostane, 12-iso-
PGF2alpha.";
J. Biol. Chem. 272:27147-27154(1997).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Placenta;
Kopatz S.A., Aronstam R.S., Sharma S.V.;
"cDNA clones of human proteins involved in signal transduction
sequenced by the Guthrie cDNA resource center (www.cdna.org).";
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND ALTERNATIVE SPLICING.
PubMed=14984197; DOI=10.1016/j.abb.2003.10.021;
Vielhauer G.A., Fujino H., Regan J.W.;
"Cloning and localization of hFP(S): a six-transmembrane mRNA splice
variant of the human FP prostanoid receptor.";
Arch. Biochem. Biophys. 421:175-185(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-266.
TISSUE=Liver;
Nishizawa M., Ito S.;
"Structure of human prostaglandin F2alpha receptor gene.";
Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases.
[10]
FUNCTION, TISSUE SPECIFICITY, ALTERNATIVE SPLICING, AND SUBUNIT.
PubMed=18587449; DOI=10.1038/bjp.2008.142;
Liang Y., Woodward D.F., Guzman V.M., Li C., Scott D.F., Wang J.W.,
Wheeler L.A., Garst M.E., Landsverk K., Sachs G., Krauss A.H.,
Cornell C., Martos J., Pettit S., Fliri H.;
"Identification and pharmacological characterization of the
prostaglandin FP receptor and FP receptor variant complexes.";
Br. J. Pharmacol. 154:1079-1093(2008).
-!- FUNCTION: Receptor for prostaglandin F2-alpha (PGF2-alpha). The
activity of this receptor is mediated by G proteins which activate
a phosphatidylinositol-calcium second messenger system. Initiates
luteolysis in the corpus luteum (By similarity). Isoforms 2 to 7
do not bind PGF2-alpha but are proposed to modulate signaling by
participating in variant receptor complexes; heterodimers between
isoform 1 and isoform 5 are proposed to be a receptor for
prostamides including the synthetic analog bimatoprost.
{ECO:0000250, ECO:0000269|PubMed:18587449}.
-!- SUBUNIT: Isoform 1 can form heterodimers with isoform 5 (and
probably other isoforms). {ECO:0000269|PubMed:18587449}.
-!- SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1;
IsoId=P43088-1; Sequence=Displayed;
Name=2; Synonyms=FP(S), VAR-1;
IsoId=P43088-2; Sequence=VSP_042025;
Name=3; Synonyms=VAR-2;
IsoId=P43088-3; Sequence=VSP_053589, VSP_053595;
Name=4; Synonyms=VAR-3;
IsoId=P43088-4; Sequence=VSP_053588, VSP_053596;
Name=5; Synonyms=altFP4, VAR-4;
IsoId=P43088-5; Sequence=VSP_053593, VSP_053597;
Name=6; Synonyms=VAR-5;
IsoId=P43088-6; Sequence=VSP_053591, VSP_053592;
Name=7; Synonyms=VAR-6;
IsoId=P43088-7; Sequence=VSP_053590, VSP_053594;
-!- TISSUE SPECIFICITY: Eye. {ECO:0000269|PubMed:18587449}.
-!- SIMILARITY: Belongs to the G-protein coupled receptor 1 family.
{ECO:0000255|PROSITE-ProRule:PRU00521}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L24470; AAA17684.1; -; mRNA.
EMBL; AF004021; AAB63152.1; -; mRNA.
EMBL; AY337000; AAQ76788.1; -; mRNA.
EMBL; AY485530; AAR84381.1; -; mRNA.
EMBL; AK292845; BAF85534.1; -; mRNA.
EMBL; AC096531; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL158841; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL136324; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471059; EAX06351.1; -; Genomic_DNA.
EMBL; BC112965; AAI12966.1; -; mRNA.
EMBL; AB041713; BAA94756.1; -; Genomic_DNA.
CCDS; CCDS30759.1; -. [P43088-2]
CCDS; CCDS686.1; -. [P43088-1]
PIR; A49973; A49973.
RefSeq; NP_000950.1; NM_000959.3. [P43088-1]
RefSeq; NP_001034674.1; NM_001039585.1. [P43088-2]
RefSeq; XP_016857362.1; XM_017001873.1. [P43088-4]
UniGene; Hs.654365; -.
ProteinModelPortal; P43088; -.
BioGrid; 111709; 13.
STRING; 9606.ENSP00000359793; -.
BindingDB; P43088; -.
ChEMBL; CHEMBL1987; -.
DrugBank; DB00905; Bimatoprost.
DrugBank; DB01160; Dinoprost Tromethamine.
DrugBank; DB00654; Latanoprost.
DrugBank; DB08819; Tafluprost.
DrugBank; DB00287; Travoprost.
GuidetoPHARMACOLOGY; 344; -.
SwissLipids; SLP:000001573; -.
iPTMnet; P43088; -.
PhosphoSitePlus; P43088; -.
BioMuta; PTGFR; -.
DMDM; 1172442; -.
PaxDb; P43088; -.
PeptideAtlas; P43088; -.
PRIDE; P43088; -.
DNASU; 5737; -.
Ensembl; ENST00000370756; ENSP00000359792; ENSG00000122420. [P43088-2]
Ensembl; ENST00000370757; ENSP00000359793; ENSG00000122420. [P43088-1]
Ensembl; ENST00000370758; ENSP00000359794; ENSG00000122420. [P43088-1]
GeneID; 5737; -.
KEGG; hsa:5737; -.
UCSC; uc001dim.4; human. [P43088-1]
CTD; 5737; -.
DisGeNET; 5737; -.
EuPathDB; HostDB:ENSG00000122420.9; -.
GeneCards; PTGFR; -.
HGNC; HGNC:9600; PTGFR.
MIM; 600563; gene.
neXtProt; NX_P43088; -.
OpenTargets; ENSG00000122420; -.
PharmGKB; PA290; -.
eggNOG; KOG3656; Eukaryota.
eggNOG; ENOG410XRW9; LUCA.
GeneTree; ENSGT00760000119188; -.
HOGENOM; HOG000015238; -.
HOVERGEN; HBG003621; -.
InParanoid; P43088; -.
KO; K04262; -.
OMA; IIFMTVG; -.
OrthoDB; EOG091G0A2S; -.
PhylomeDB; P43088; -.
TreeFam; TF324982; -.
Reactome; R-HSA-391908; Prostanoid ligand receptors.
Reactome; R-HSA-416476; G alpha (q) signalling events.
GeneWiki; Prostaglandin_F_receptor; -.
GenomeRNAi; 5737; -.
PRO; PR:P43088; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000122420; -.
CleanEx; HS_PTGFR; -.
ExpressionAtlas; P43088; baseline and differential.
Genevisible; P43088; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005576; C:extracellular region; IDA:MGI.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0004958; F:prostaglandin F receptor activity; IDA:UniProtKB.
GO; GO:0035584; P:calcium-mediated signaling using intracellular calcium source; IDA:UniProtKB.
GO; GO:0071799; P:cellular response to prostaglandin D stimulus; IMP:UniProtKB.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; TAS:Reactome.
GO; GO:0043066; P:negative regulation of apoptotic process; IEA:Ensembl.
GO; GO:0007567; P:parturition; TAS:ProtInc.
GO; GO:0008284; P:positive regulation of cell proliferation; IMP:UniProtKB.
GO; GO:0010628; P:positive regulation of gene expression; IEA:Ensembl.
GO; GO:0032355; P:response to estradiol; IEA:Ensembl.
GO; GO:0032496; P:response to lipopolysaccharide; IEA:Ensembl.
CDD; cd15145; 7tmA_FP; 1.
InterPro; IPR000276; GPCR_Rhodpsn.
InterPro; IPR017452; GPCR_Rhodpsn_7TM.
InterPro; IPR000141; PglndnF_rcpt.
InterPro; IPR008365; Prostanoid_rcpt.
PANTHER; PTHR11866; PTHR11866; 1.
PANTHER; PTHR11866:SF4; PTHR11866:SF4; 1.
Pfam; PF00001; 7tm_1; 1.
PRINTS; PR00237; GPCRRHODOPSN.
PRINTS; PR01788; PROSTANOIDR.
PRINTS; PR00855; PRSTNOIDFPR.
PROSITE; PS00237; G_PROTEIN_RECEP_F1_1; 1.
PROSITE; PS50262; G_PROTEIN_RECEP_F1_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; G-protein coupled receptor; Glycoprotein; Membrane;
Receptor; Reference proteome; Transducer; Transmembrane;
Transmembrane helix.
CHAIN 1 359 Prostaglandin F2-alpha receptor.
/FTId=PRO_0000070070.
TOPO_DOM 1 31 Extracellular. {ECO:0000255}.
TRANSMEM 32 54 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 55 69 Cytoplasmic. {ECO:0000255}.
TRANSMEM 70 90 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 91 109 Extracellular. {ECO:0000255}.
TRANSMEM 110 131 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 132 152 Cytoplasmic. {ECO:0000255}.
TRANSMEM 153 175 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 176 198 Extracellular. {ECO:0000255}.
TRANSMEM 199 224 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 225 250 Cytoplasmic. {ECO:0000255}.
TRANSMEM 251 267 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 268 285 Extracellular. {ECO:0000255}.
TRANSMEM 286 307 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 308 359 Cytoplasmic. {ECO:0000255}.
CARBOHYD 4 4 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 19 19 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 108 186 {ECO:0000255|PROSITE-ProRule:PRU00521}.
VAR_SEQ 267 359 VTMANIGINGNHSLETCETTLFALRMATWNQILDPWVYILL
RKAVLKNLYKLASQCCGVHVISLHIWELSSIKNSLKVAAIS
ESPVAEKSAST -> GYRIILNGKEKYKVYEEQSDFLHRLQ
WPTLE (in isoform 2).
{ECO:0000303|PubMed:14984197}.
/FTId=VSP_042025.
VAR_SEQ 267 291 VTMANIGINGNHSLETCETTLFALR -> GYRIILNGKEKY
KVYEEQSDFLHRK (in isoform 4).
{ECO:0000305}.
/FTId=VSP_053588.
VAR_SEQ 267 275 VTMANIGIN -> KIEGKIKVT (in isoform 3).
{ECO:0000305}.
/FTId=VSP_053589.
VAR_SEQ 267 274 VTMANIGI -> THWGKEIP (in isoform 7).
{ECO:0000305}.
/FTId=VSP_053590.
VAR_SEQ 267 267 V -> R (in isoform 6). {ECO:0000305}.
/FTId=VSP_053591.
VAR_SEQ 268 359 Missing (in isoform 6). {ECO:0000305}.
/FTId=VSP_053592.
VAR_SEQ 268 296 TMANIGINGNHSLETCETTLFALRMATWN -> KETHLQMR
LWTWDFRVNALEDYCEGLTVF (in isoform 5).
{ECO:0000305}.
/FTId=VSP_053593.
VAR_SEQ 275 359 Missing (in isoform 7). {ECO:0000305}.
/FTId=VSP_053594.
VAR_SEQ 276 359 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_053595.
VAR_SEQ 292 359 Missing (in isoform 4). {ECO:0000305}.
/FTId=VSP_053596.
VAR_SEQ 297 359 Missing (in isoform 5). {ECO:0000305}.
/FTId=VSP_053597.
SEQUENCE 359 AA; 40055 MW; 08077045C0B20BCA CRC64;
MSMNNSKQLV SPAAALLSNT TCQTENRLSV FFSVIFMTVG ILSNSLAIAI LMKAYQRFRQ
KSKASFLLLA SGLVITDFFG HLINGAIAVF VYASDKEWIR FDQSNVLCSI FGICMVFSGL
CPLLLGSVMA IERCIGVTKP IFHSTKITSK HVKMMLSGVC LFAVFIALLP ILGHRDYKIQ
ASRTWCFYNT EDIKDWEDRF YLLLFSFLGL LALGVSLLCN AITGITLLRV KFKSQQHRQG
RSHHLEMVIQ LLAIMCVSCI CWSPFLVTMA NIGINGNHSL ETCETTLFAL RMATWNQILD
PWVYILLRKA VLKNLYKLAS QCCGVHVISL HIWELSSIKN SLKVAAISES PVAEKSAST


Related products :

Catalog number Product name Quantity
E0749h ELISA kit Homo sapiens,Human,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,PTGFR 96T
E0749h ELISA Homo sapiens,Human,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,PTGFR 96T
U0749h CLIA Homo sapiens,Human,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,PTGFR 96T
U0749m CLIA Mouse,Mus musculus,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,Ptgfr 96T
E0749b ELISA Bos taurus,Bovine,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,PTGFR 96T
E0749r ELISA kit PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,Ptgfr,Rat,Rattus norvegicus 96T
E0749b ELISA kit Bos taurus,Bovine,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,PTGFR 96T
U0749b CLIA Bos taurus,Bovine,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,PTGFR 96T
E0749m ELISA kit Mouse,Mus musculus,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,Ptgfr 96T
E0749m ELISA Mouse,Mus musculus,PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,Ptgfr 96T
E0749r ELISA PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,Ptgfr,Rat,Rattus norvegicus 96T
U0749r CLIA PGF receptor,PGF2-alpha receptor,Prostaglandin F2-alpha receptor,Prostanoid FP receptor,Ptgfr,Rat,Rattus norvegicus 96T
18-461-10319 Prostaglandin F2-alpha receptor - Prostanoid FP receptor; PGF receptor; PGF2 alpha receptor Polyclonal 0.05 ml
18-461-10599 Prostaglandin F2-alpha receptor - Prostanoid FP receptor; PGF receptor; PGF2 alpha receptor Polyclonal 0.05 ml
18-461-10320 Prostaglandin F2-alpha receptor - Prostanoid FP receptor; PGF receptor; PGF2 alpha receptor Polyclonal 0.05 ml
EIAAB30985 Homo sapiens,Human,PGI receptor,PGI2 receptor,PRIPR,Prostacyclin receptor,Prostaglandin I2 receptor,Prostanoid IP receptor,PTGIR
EIAAB30983 Mouse,Mus musculus,PGI receptor,PGI2 receptor,Prostacyclin receptor,Prostaglandin I2 receptor,Prostanoid IP receptor,Ptgir
EIAAB30982 Bos taurus,Bovine,PGI receptor,PGI2 receptor,Prostacyclin receptor,Prostaglandin I2 receptor,Prostanoid IP receptor,PTGIR
EIAAB30984 PGI receptor,PGI2 receptor,Prostacyclin receptor,Prostaglandin I2 receptor,Prostanoid IP receptor,Ptgir,Rat,Rattus norvegicus
EIAAB30247 PGD receptor-like,PGD2 receptor-like,Prostaglandin D2 receptor-like,Prostanoid DP receptor-like,Ptgdr2,Ptgdrl,Rat,Rattus norvegicus
EIAAB30246 Homo sapiens,Human,PGD receptor,PGD2 receptor,Prostaglandin D2 receptor,Prostanoid DP receptor,PTGDR
EIAAB30243 PGD receptor,PGD2 receptor,Prostaglandin D2 receptor,Prostanoid DP receptor,Ptgdr,Rat,Rattus norvegicus
EIAAB30244 Bos taurus,Bovine,PGD receptor,PGD2 receptor,Prostaglandin D2 receptor,Prostanoid DP receptor,PTGDR
EIAAB30245 Mouse,Mus musculus,PGD receptor,PGD2 receptor,Prostaglandin D2 receptor,Prostanoid DP receptor,Ptgdr
18-461-10531 Prostacyclin receptor - Prostanoid IP receptor; PGI receptor; Prostaglandin I2 receptor Polyclonal 0.05 ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur