Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein BRICK1 (BRK1)

 BRK1_HUMAN              Reviewed;          75 AA.
Q8WUW1; B2R5E2; Q9P082;
03-APR-2007, integrated into UniProtKB/Swiss-Prot.
01-MAR-2002, sequence version 1.
18-JUL-2018, entry version 135.
RecName: Full=Protein BRICK1;
Short=BRK1;
Name=BRK1; Synonyms=C3orf10; ORFNames=HSPC300, MDS027;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Fetal brain, and Lung;
Xu Q., Duan R., Huo Y., Fan B., Zhang K., Wu D.;
Submitted (SEP-2002) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Umbilical cord blood;
Ye M., Zhang Q.-H., Zhou J., Shen Y., Wu X.-Y., Guan Z.Q., Wang L.,
Fan H.-Y., Mao Y.-F., Dai M., Huang Q.-H., Chen S.-J., Chen Z.;
"Human partial CDS from CD34+ stem cells.";
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Hippocampus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung, and Lymph;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
INTERACTION WITH WASF2.
PubMed=15070726; DOI=10.1073/pnas.0400628101;
Gautreau A., Ho H.-Y., Li J., Steen H., Gygi S.P., Kirschner M.W.;
"Purification and architecture of the ubiquitous Wave complex.";
Proc. Natl. Acad. Sci. U.S.A. 101:4379-4383(2004).
[7]
FUNCTION, AND SUBUNIT.
PubMed=18560548; DOI=10.1371/journal.pone.0002462;
Derivery E., Fink J., Martin D., Houdusse A., Piel M., Stradal T.E.,
Louvard D., Gautreau A.;
"Free Brick1 is a trimeric precursor in the assembly of a functional
wave complex.";
PLoS ONE 3:E2462-E2462(2008).
[8]
ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, CLEAVAGE OF INITIATOR
METHIONINE [LARGE SCALE ANALYSIS], AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19413330; DOI=10.1021/ac9004309;
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,
Mohammed S.;
"Lys-N and trypsin cover complementary parts of the phosphoproteome in
a refined SCX-based approach.";
Anal. Chem. 81:4493-4501(2009).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[10]
ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, CLEAVAGE OF INITIATOR
METHIONINE [LARGE SCALE ANALYSIS], AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=22814378; DOI=10.1073/pnas.1210303109;
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A.,
Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E.,
Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K.,
Aldabe R.;
"N-terminal acetylome analyses and functional insights of the N-
terminal acetyltransferase NatB.";
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012).
[11]
X-RAY CRYSTALLOGRAPHY (2.29 ANGSTROMS) OF WAVE1 COMPLEX, AND SUBUNIT.
PubMed=21107423; DOI=10.1038/nature09623;
Chen Z., Borek D., Padrick S.B., Gomez T.S., Metlagel Z., Ismail A.M.,
Umetani J., Billadeau D.D., Otwinowski Z., Rosen M.K.;
"Structure and control of the actin regulatory WAVE complex.";
Nature 468:533-538(2010).
-!- FUNCTION: Involved in regulation of actin and microtubule
organization. Part of a WAVE complex that activates the Arp2/3
complex. As component of the WAVE1 complex, required for BDNF-
NTRK2 endocytic trafficking and signaling from early endosomes (By
similarity). {ECO:0000250|UniProtKB:Q91VR8,
ECO:0000269|PubMed:18560548}.
-!- SUBUNIT: Homotrimer when in free form. Directly interacts with
WASF2. Component of the WAVE1 complex composed of ABI2, CYFIP1 or
CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a
heterodimer containing NCKAP1 and CYFIP1 interacts with a
heterotrimer formed by WAVE1, ABI2 and BRK1.
{ECO:0000269|PubMed:15070726, ECO:0000269|PubMed:18560548,
ECO:0000269|PubMed:21107423}.
-!- INTERACTION:
Q96EV8:DTNBP1; NbExp=3; IntAct=EBI-2837444, EBI-465804;
O75506:HSBP1; NbExp=4; IntAct=EBI-2837444, EBI-748664;
-!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q8WUW1-1; Sequence=Displayed;
Name=2;
IsoId=Q8WUW1-2; Sequence=VSP_024350;
Note=No experimental confirmation available.;
-!- SIMILARITY: Belongs to the BRK1 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAF28978.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AY148219; AAN60161.1; -; mRNA.
EMBL; AY148220; AAN60162.1; -; mRNA.
EMBL; AF161418; AAF28978.1; ALT_INIT; mRNA.
EMBL; AK312155; BAG35089.1; -; mRNA.
EMBL; CH471055; EAW64061.1; -; Genomic_DNA.
EMBL; BC001067; AAH01067.1; -; mRNA.
EMBL; BC007929; AAH07929.1; -; mRNA.
EMBL; BC019303; AAH19303.1; -; mRNA.
CCDS; CCDS54553.1; -. [Q8WUW1-1]
RefSeq; NP_060932.2; NM_018462.4. [Q8WUW1-1]
UniGene; Hs.649307; -.
PDB; 3P8C; X-ray; 2.29 A; E=1-75.
PDB; 4N78; X-ray; 2.43 A; E=1-75.
PDBsum; 3P8C; -.
PDBsum; 4N78; -.
ProteinModelPortal; Q8WUW1; -.
SMR; Q8WUW1; -.
BioGrid; 120947; 25.
CORUM; Q8WUW1; -.
DIP; DIP-41554N; -.
IntAct; Q8WUW1; 33.
MINT; Q8WUW1; -.
STRING; 9606.ENSP00000432472; -.
ChEMBL; CHEMBL3758062; -.
iPTMnet; Q8WUW1; -.
PhosphoSitePlus; Q8WUW1; -.
BioMuta; BRK1; -.
DMDM; 74730773; -.
EPD; Q8WUW1; -.
MaxQB; Q8WUW1; -.
PaxDb; Q8WUW1; -.
PeptideAtlas; Q8WUW1; -.
PRIDE; Q8WUW1; -.
ProteomicsDB; 74714; -.
ProteomicsDB; 74715; -. [Q8WUW1-2]
TopDownProteomics; Q8WUW1-1; -. [Q8WUW1-1]
TopDownProteomics; Q8WUW1-2; -. [Q8WUW1-2]
DNASU; 55845; -.
Ensembl; ENST00000530758; ENSP00000432472; ENSG00000254999. [Q8WUW1-1]
GeneID; 55845; -.
KEGG; hsa:55845; -.
UCSC; uc003bvb.4; human. [Q8WUW1-1]
CTD; 55845; -.
DisGeNET; 55845; -.
EuPathDB; HostDB:ENSG00000254999.3; -.
GeneCards; BRK1; -.
HGNC; HGNC:23057; BRK1.
HPA; HPA060391; -.
MIM; 611183; gene.
neXtProt; NX_Q8WUW1; -.
OpenTargets; ENSG00000254999; -.
PharmGKB; PA134866423; -.
eggNOG; ENOG410J0X8; Eukaryota.
eggNOG; ENOG4111UHX; LUCA.
GeneTree; ENSGT00390000011082; -.
HOVERGEN; HBG107432; -.
InParanoid; Q8WUW1; -.
KO; K05752; -.
OMA; EACVTQG; -.
OrthoDB; EOG091G172W; -.
PhylomeDB; Q8WUW1; -.
TreeFam; TF324876; -.
Reactome; R-HSA-2029482; Regulation of actin dynamics for phagocytic cup formation.
Reactome; R-HSA-4420097; VEGFA-VEGFR2 Pathway.
Reactome; R-HSA-5663213; RHO GTPases Activate WASPs and WAVEs.
SIGNOR; Q8WUW1; -.
ChiTaRS; BRK1; human.
EvolutionaryTrace; Q8WUW1; -.
GeneWiki; C3orf10; -.
GenomeRNAi; 55845; -.
PRO; PR:Q8WUW1; -.
Proteomes; UP000005640; Chromosome 3.
Bgee; ENSG00000254999; -.
CleanEx; HS_C3orf10; -.
Genevisible; Q8WUW1; HS.
GO; GO:0005856; C:cytoskeleton; IEA:UniProtKB-SubCell.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
GO; GO:0030027; C:lamellipodium; ISS:UniProtKB.
GO; GO:0031209; C:SCAR complex; IDA:UniProtKB.
GO; GO:0044877; F:protein-containing complex binding; IDA:UniProtKB.
GO; GO:0007015; P:actin filament organization; IEA:InterPro.
GO; GO:0048870; P:cell motility; IBA:GO_Central.
GO; GO:0038096; P:Fc-gamma receptor signaling pathway involved in phagocytosis; TAS:Reactome.
GO; GO:0001701; P:in utero embryonic development; IEA:Ensembl.
GO; GO:2000601; P:positive regulation of Arp2/3 complex-mediated actin nucleation; IDA:UniProtKB.
GO; GO:0008284; P:positive regulation of cell proliferation; IEA:Ensembl.
GO; GO:0010592; P:positive regulation of lamellipodium assembly; IMP:UniProtKB.
GO; GO:0070207; P:protein homotrimerization; IDA:UniProtKB.
GO; GO:0016601; P:Rac protein signal transduction; IDA:UniProtKB.
GO; GO:0048010; P:vascular endothelial growth factor receptor signaling pathway; TAS:Reactome.
InterPro; IPR033378; BRICK1.
PANTHER; PTHR33668; PTHR33668; 1.
ProDom; PD593487; PD593487; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Coiled coil;
Complete proteome; Cytoplasm; Cytoskeleton; Reference proteome.
INIT_MET 1 1 Removed. {ECO:0000244|PubMed:19413330,
ECO:0000244|PubMed:22814378}.
CHAIN 2 75 Protein BRICK1.
/FTId=PRO_0000283646.
COILED 41 72 {ECO:0000255}.
MOD_RES 2 2 N-acetylalanine.
{ECO:0000244|PubMed:19413330,
ECO:0000244|PubMed:22814378}.
VAR_SEQ 75 75 T -> TRTVPCCCWEVALHNTGHMGKAPAAFSSFLSP (in
isoform 2). {ECO:0000303|Ref.2}.
/FTId=VSP_024350.
HELIX 11 68 {ECO:0000244|PDB:3P8C}.
SEQUENCE 75 AA; 8745 MW; 637B5461A2D96587 CRC64;
MAGQEDPVQR EIHQDWANRE YIEIITSSIK KIADFLNSFD MSCRSRLATL NEKLTALERR
IEYIEARVTK GETLT


Related products :

Catalog number Product name Quantity
BRK1_MOUSE ELISA Kit FOR Protein BRICK1; organism: Mouse; gene name: Brk1 96T
BRK1_HUMAN ELISA Kit FOR Protein BRICK1; organism: Human; gene name: BRK1 96T
Y123037 Anti_Probable protein BRICK1 100ul
E14250h Mouse ELISA Kit FOR Protein BRICK1 96T
orb12570 Probable protein BRICK1 antibody 100 ug
CSB-EL003892HU Human Protein BRICK1(C3orf10) ELISA kit 96T
Y123037 Anti-Probable protein BRICK1 Antibody 100ul
G2478 Protein BRICK1 (C3orf10), Human, ELISA Kit 96T
CSB-EL003892HU Human Protein BRICK1(C3orf10) ELISA kit SpeciesHuman 96T
orb120861 Probable protein BRICK1 antibody Monoclonal Antibodies Primary antibodies 100
orb12570 Probable protein BRICK1 antibody Monoclonal Antibodies Primary antibodies 100
065542A Brk1 250ul
i065007 Brk1-set siRNA_Lentivectors 4x500ng
i065007a Brk1 siRNA_Lentivectors 500ng
i065007b Brk1 siRNA_Lentivectors 500ng
i065007c Brk1 siRNA_Lentivectors 500ng
i065007d Brk1 siRNA_Lentivectors 500ng
ARP51212_T100 BRICK1 _ C3orf10 100 µg
ARP51212_T100 BRICK1 _ C3orf10 0.1 mg
ATGP2513 BRK1, 1-75aa, Human, His tag, E.coli 0.5mg
ATGP2513 BRK1, 1-75aa, Human, His tag, E.coli 100ug
ATGP2513 BRK1, 1-75aa, Human, His tag, E.coli , Signal Transduction 0.5mg
ATGP2513 BRK1, 1-75aa, Human, His tag, E.coli , Signal Transduction 100ug
'ARP51212_T100 BRICK1 _ C3orf10 antibody Host rabbit 0.1 mg
'ARP51212_T100 BRICK1 C3orf10 antibody Host rabbit 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur