Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein DEFECTIVE IN EXINE FORMATION 1

 DEX1_ARATH              Reviewed;         896 AA.
F4IYM4; B3H6A9; F4IYM3; Q84TH7; Q9FV29; Q9FV30; Q9SS78;
04-FEB-2015, integrated into UniProtKB/Swiss-Prot.
28-JUN-2011, sequence version 1.
25-APR-2018, entry version 58.
RecName: Full=Protein DEFECTIVE IN EXINE FORMATION 1 {ECO:0000303|PubMed:11743117};
Flags: Precursor;
Name=DEX1 {ECO:0000303|PubMed:11743117};
OrderedLocusNames=At3g09090 {ECO:0000312|Araport:AT3G09090};
ORFNames=MZB10.12 {ECO:0000312|EMBL:AAD56325.1};
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702 {ECO:0000312|Proteomes:UP000006548};
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), FUNCTION,
DISRUPTION PHENOTYPE, AND TISSUE SPECIFICITY.
STRAIN=cv. Wassilewskija;
PubMed=11743117; DOI=10.1104/pp.127.4.1739;
Paxson-Sowders D.M., Dodrill C.H., Owen H.A., Makaroff C.A.;
"DEX1, a novel plant protein, is required for exine pattern formation
during pollen development in Arabidopsis.";
Plant Physiol. 127:1739-1749(2001).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=11130713; DOI=10.1038/35048706;
Salanoubat M., Lemcke K., Rieger M., Ansorge W., Unseld M.,
Fartmann B., Valle G., Bloecker H., Perez-Alonso M., Obermaier B.,
Delseny M., Boutry M., Grivell L.A., Mache R., Puigdomenech P.,
De Simone V., Choisne N., Artiguenave F., Robert C., Brottier P.,
Wincker P., Cattolico L., Weissenbach J., Saurin W., Quetier F.,
Schaefer M., Mueller-Auer S., Gabel C., Fuchs M., Benes V.,
Wurmbach E., Drzonek H., Erfle H., Jordan N., Bangert S.,
Wiedelmann R., Kranz H., Voss H., Holland R., Brandt P., Nyakatura G.,
Vezzi A., D'Angelo M., Pallavicini A., Toppo S., Simionati B.,
Conrad A., Hornischer K., Kauer G., Loehnert T.-H., Nordsiek G.,
Reichelt J., Scharfe M., Schoen O., Bargues M., Terol J., Climent J.,
Navarro P., Collado C., Perez-Perez A., Ottenwaelder B., Duchemin D.,
Cooke R., Laudie M., Berger-Llauro C., Purnelle B., Masuy D.,
de Haan M., Maarse A.C., Alcaraz J.-P., Cottet A., Casacuberta E.,
Monfort A., Argiriou A., Flores M., Liguori R., Vitale D.,
Mannhaupt G., Haase D., Schoof H., Rudd S., Zaccaria P., Mewes H.-W.,
Mayer K.F.X., Kaul S., Town C.D., Koo H.L., Tallon L.J., Jenkins J.,
Rooney T., Rizzo M., Walts A., Utterback T., Fujii C.Y., Shea T.P.,
Creasy T.H., Haas B., Maiti R., Wu D., Peterson J., Van Aken S.,
Pai G., Militscher J., Sellers P., Gill J.E., Feldblyum T.V.,
Preuss D., Lin X., Nierman W.C., Salzberg S.L., White O., Venter J.C.,
Fraser C.M., Kaneko T., Nakamura Y., Sato S., Kato T., Asamizu E.,
Sasamoto S., Kimura T., Idesawa K., Kawashima K., Kishida Y.,
Kiyokawa C., Kohara M., Matsumoto M., Matsuno A., Muraki A.,
Nakayama S., Nakazaki N., Shinpo S., Takeuchi C., Wada T.,
Watanabe A., Yamada M., Yasuda M., Tabata S.;
"Sequence and analysis of chromosome 3 of the plant Arabidopsis
thaliana.";
Nature 408:820-822(2000).
[3]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-896 (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 6-896 (ISOFORM 1).
STRAIN=cv. Columbia;
Totoki Y., Seki M., Ishida J., Nakajima M., Enju A., Kamiya A.,
Narusaka M., Shin-i T., Nakagawa M., Sakamoto N., Oishi K., Kohara Y.,
Kobayashi M., Toyoda A., Sakaki Y., Sakurai T., Iida K., Akiyama K.,
Satou M., Toyoda T., Konagaya A., Carninci P., Kawai J.,
Hayashizaki Y., Shinozaki K.;
"Large-scale analysis of RIKEN Arabidopsis full-length (RAFL) cDNAs.";
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases.
-!- FUNCTION: Required for exine pattern formation during pollen
development, especially for primexine deposition.
{ECO:0000269|PubMed:11743117}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000255}; Single-pass
type I membrane protein {ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=F4IYM4-1; Sequence=Displayed;
Name=2;
IsoId=F4IYM4-2; Sequence=VSP_057386;
Note=Derived from EST data. No experimental confirmation
available. {ECO:0000312|EMBL:AEE74720.1};
Name=3;
IsoId=F4IYM4-3; Sequence=VSP_057387;
Note=Derived from EST data. No experimental confirmation
available. {ECO:0000312|EMBL:AEE74721.1};
-!- TISSUE SPECIFICITY: Mostly expressed in buds, and, to a lower
extent, in leaves, roots and seedlings.
{ECO:0000269|PubMed:11743117}.
-!- DISRUPTION PHENOTYPE: Male sterile. Defective pollen wall pattern
formation at early tetrad stage; delayed and reduced primexine
deposition, as well as abnormal rippling of the plasma membrane
and no production of spacers. Random sporopollenin deposition on
the plasma membrane along the microspore wall.
{ECO:0000269|PubMed:11743117}.
-!- SEQUENCE CAUTION:
Sequence=AAD56325.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF257186; AAG31444.1; -; Genomic_DNA.
EMBL; AF257187; AAG31445.1; -; mRNA.
EMBL; AC009326; AAD56325.1; ALT_SEQ; Genomic_DNA.
EMBL; CP002686; AEE74719.1; -; Genomic_DNA.
EMBL; CP002686; AEE74720.1; -; Genomic_DNA.
EMBL; CP002686; AEE74721.1; -; Genomic_DNA.
EMBL; BT005785; AAO64188.1; -; mRNA.
EMBL; AK228583; BAF00499.1; -; mRNA.
RefSeq; NP_001118602.1; NM_001125130.1. [F4IYM4-2]
RefSeq; NP_001189844.1; NM_001202915.1. [F4IYM4-3]
RefSeq; NP_566343.1; NM_111744.5. [F4IYM4-1]
UniGene; At.16907; -.
UniGene; At.69661; -.
ProteinModelPortal; F4IYM4; -.
SMR; F4IYM4; -.
STRING; 3702.AT3G09090.1; -.
PaxDb; F4IYM4; -.
EnsemblPlants; AT3G09090.1; AT3G09090.1; AT3G09090. [F4IYM4-1]
EnsemblPlants; AT3G09090.2; AT3G09090.2; AT3G09090. [F4IYM4-2]
EnsemblPlants; AT3G09090.3; AT3G09090.3; AT3G09090. [F4IYM4-3]
GeneID; 820063; -.
Gramene; AT3G09090.1; AT3G09090.1; AT3G09090. [F4IYM4-1]
Gramene; AT3G09090.2; AT3G09090.2; AT3G09090. [F4IYM4-2]
Gramene; AT3G09090.3; AT3G09090.3; AT3G09090. [F4IYM4-3]
KEGG; ath:AT3G09090; -.
Araport; AT3G09090; -.
TAIR; locus:2095274; AT3G09090.
eggNOG; ENOG410IEFE; Eukaryota.
eggNOG; ENOG410ZQCN; LUCA.
HOGENOM; HOG000030812; -.
InParanoid; F4IYM4; -.
OMA; AYRYNRE; -.
OrthoDB; EOG0936021C; -.
PRO; PR:F4IYM4; -.
Proteomes; UP000006548; Chromosome 3.
ExpressionAtlas; F4IYM4; baseline and differential.
Genevisible; F4IYM4; AT.
GO; GO:0005783; C:endoplasmic reticulum; IDA:TAIR.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0016020; C:membrane; ISS:TAIR.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005509; F:calcium ion binding; ISS:TAIR.
GO; GO:0071555; P:cell wall organization; IEA:UniProtKB-KW.
GO; GO:0010584; P:pollen exine formation; IMP:UniProtKB.
GO; GO:0010208; P:pollen wall assembly; IMP:TAIR.
Gene3D; 2.130.10.10; -; 1.
InterPro; IPR013517; FG-GAP.
InterPro; IPR015943; WD40/YVTN_repeat-like_dom_sf.
Pfam; PF01839; FG-GAP; 1.
2: Evidence at transcript level;
Alternative splicing; Cell membrane; Cell wall biogenesis/degradation;
Complete proteome; Glycoprotein; Membrane; Reference proteome; Signal;
Transmembrane; Transmembrane helix.
SIGNAL 1 24 {ECO:0000255}.
CHAIN 25 896 Protein DEFECTIVE IN EXINE FORMATION 1.
{ECO:0000255}.
/FTId=PRO_0000431810.
TOPO_DOM 25 858 Extracellular. {ECO:0000255}.
TRANSMEM 859 879 Helical. {ECO:0000255}.
TOPO_DOM 880 896 Cytoplasmic. {ECO:0000255}.
CARBOHYD 20 20 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 204 204 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 211 211 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 239 239 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 253 253 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 266 266 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 279 279 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 295 295 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 302 302 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 307 307 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 317 317 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 789 789 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
VAR_SEQ 791 894 TTTLLVPGNYQGERRITQSQIYDRPGKYRIKLPTVGVRTTG
TVMVEMADKNGLHFSDEFSLTFHMYYYKLLKWLLVLPMLGM
FGLLVILRPQEAVPLPSFSRNT -> TLFSNTDDAVGSRQL
PGREEDNAEP (in isoform 2).
/FTId=VSP_057386.
VAR_SEQ 875 896 LLVILRPQEAVPLPSFSRNTDL -> GTHPHRAHQKDPGTI
SC (in isoform 3).
/FTId=VSP_057387.
CONFLICT 229 229 T -> I (in Ref. 1; AAG31445).
{ECO:0000305}.
CONFLICT 367 367 A -> R (in Ref. 1; AAG31445/AAG31444).
{ECO:0000305}.
SEQUENCE 896 AA; 99711 MW; 027B36C638763C83 CRC64;
MKSRARQCLL VCLLCLSLTN LSYGENKFRE RKATDDELGY PDIDEDALLN TQCPKKLELR
WQTEVTSSVY ATPLIADINS DGKLDIVVPS FVHYLEVLEG ADGDKMPGWP AFHQSNVHSS
PLLFDIDKDG VREIALATYN AEVLFFRVSG FLMSDKLEVP RRKVHKNWHV GLNPDPVDRS
HPDVHDDVLE EEAMAMKSST TQTNATTTTP NVTVSMTKEV HGANSYVSTQ EDQKRPENNQ
TEAIVKPTPE LHNSSMDAGA NNLAANATTA GSRENLNRNV TTNEVDQSKI SGDKNETVIK
LNTSTGNSSE TLGTSGNSST AETVTKSGRR LLEEDGSKES VDSHSDSKDN SEGVRMATVE
NDGGLEADAD SSFELLREND ELADEYSYDY DDYVDEKMWG DEEWVEGQHE NSEDYVNIDA
HILCTPVIAD IDKDGVQEMI VAVSYFFDPE YYDNPEHLKE LGGIDIKNYI ASSIVVFNLD
TKQVKWIKEL DLSTDKANFR AYIYSSPTVV DLDGDGYLDI LVGTSFGLFY AMDHRGNIRE
KFPLEMAEIQ GAVVAADIND DGKIELVTTD SHGNIAAWTT QGVEIWEAHL KSLVPQGPSI
GDVDGDGHTE VVVPTSSGNI YVLSGKDGSI VRPYPYRTHG RVMNQLLLVD LNKRGEKKKG
LTIVTTSFDG YLYLIDGPTS CTDVVDIGET SYSMVLADNV DGGDDLDLIV STMNGNVFCF
STPSPHHPLK AWRSSDQGRN NKANRYDREG VFVTHSTRGF RDEEGKNFWA EIEIVDKYRY
PSGSQAPYNV TTTLLVPGNY QGERRITQSQ IYDRPGKYRI KLPTVGVRTT GTVMVEMADK
NGLHFSDEFS LTFHMYYYKL LKWLLVLPML GMFGLLVILR PQEAVPLPSF SRNTDL


Related products :

Catalog number Product name Quantity
26-827 MLF1 is involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. It interferes with erythopoietin-induced erythroid termina 0.05 mg
EIAAB10617 DCN1-like protein 1,DCUN1 domain-containing protein 1,Dcun1d1,Dcun1l1,Defective in cullin neddylation protein 1-like protein 1,Mouse,Mus musculus,Rp42,Tes3,Testis-specific protein 3
EIAAB10624 DCN1-like protein 4,DCUN1 domain-containing protein 4,Dcun1d4,Defective in cullin neddylation protein 1-like protein 4,Mouse,Mus musculus
EIAAB10620 DCN1-like protein 3,DCUN1 domain-containing protein 3,Dcun1d3,Defective in cullin neddylation protein 1-like protein 3,Rat,Rattus norvegicus
EIAAB10621 Bos taurus,Bovine,DCN1-like protein 3,DCUN1 domain-containing protein 3,DCUN1D3,Defective in cullin neddylation protein 1-like protein 3
EIAAB10628 DCN1-like protein 5,DCUN1 domain-containing protein 5,Dcun1d5,Defective in cullin neddylation protein 1-like protein 5,Rat,Rattus norvegicus
EIAAB10627 DCN1-like protein 5,DCUN1 domain-containing protein 5,Dcun1d5,Defective in cullin neddylation protein 1-like protein 5,Mouse,Mus musculus
EIAAB10626 Bos taurus,Bovine,DCN1-like protein 5,DCUN1 domain-containing protein 5,DCUN1D5,Defective in cullin neddylation protein 1-like protein 5
EIAAB10623 DCN1-like protein 3,DCUN1 domain-containing protein 3,Dcun1d3,Defective in cullin neddylation protein 1-like protein 3,Mouse,Mus musculus
EIAAB10622 DCN1-like protein 3,DCUN1 domain-containing protein 3,DCUN1D3,Defective in cullin neddylation protein 1-like protein 3,Homo sapiens,Human
EIAAB10619 DCN1-like protein 2,DCUN1 domain-containing protein 2,Dcun1d2,Dcun1l2,Defective in cullin neddylation protein 1-like protein 2,Mouse,Mus musculus
EIAAB10629 DCN1-like protein 5,DCUN1 domain-containing protein 5,DCUN1D5,Defective in cullin neddylation protein 1-like protein 5,Homo sapiens,Human
EIAAB10625 DCN1-like protein 4,DCUN1 domain-containing protein 4,DCUN1D4,Defective in cullin neddylation protein 1-like protein 4,Homo sapiens,Human,KIAA0276
EIAAB10618 C13orf17,DCN1-like protein 2,DCUN1 domain-containing protein 2,DCUN1D2,DCUN1L2,Defective in cullin neddylation protein 1-like protein 2,Homo sapiens,Human
29-479 EIF2A is a 65-kD protein that catalyzes the formation of puromycin-sensitive 80S preinitiation complexes.EIF2A is a 65-kD protein that catalyzes the formation of puromycin-sensitive 80S preinitiation 0.1 mg
NCM-R200 NanoCulture Medium (Qualifed for Spheriod Formation) NanoCulture Media has been qualified to facilite spheriod formation in cultures. NanoCulture Medium M (NCM_M) containing BSA works with a wide ran 4 x 50 ml
NCM-M100 NanoCulture Medium (Qualifed for Spheriod Formation) NanoCulture Media has been qualified to facilite spheriod formation in cultures. NanoCulture Medium M (NCM_M) containing BSA works with a wide ran 2 x 50 ml
NCM-R100 NanoCulture Medium (Qualifed for Spheriod Formation) NanoCulture Media has been qualified to facilite spheriod formation in cultures. NanoCulture Medium M (NCM_M) containing BSA works with a wide ran 2 x 50 ml
NCM-M200 NanoCulture Medium (Qualifed for Spheriod Formation) NanoCulture Media has been qualified to facilite spheriod formation in cultures. NanoCulture Medium M (NCM_M) containing BSA works with a wide ran 4 x 50 ml
EIAAB10615 DCN1-like protein 1,DCUN1 domain-containing protein 1,DCUN1D1,DCUN1L1,Defective in cullin neddylation protein 1-like protein 1,Homo sapiens,Human,RP42,SCCRO,Squamous cell carcinoma-related oncogene
Y050800 Anti_daf_2(Abnormal dauer formation protein 2) 100ug
EIAAB10616 Chicken,DCN1-like protein 1,DCUN1 domain-containing protein 1,DCUN1D1,DCUN1L1,Defective in cullin neddylation protein 1-like protein 1,Gallus gallus,RCJMB04_9c8
Y050800 Anti-daf-2Abnormal dauer formation protein 2 antibody 250ug
Y050800 Anti-daf-2(Abnormal dauer formation protein 2) Antibody 100ug
29-694 SEMG1 is the predominant protein in semen. The secreted protein is involved in the formation of a gel matrix that encases ejaculated spermatozoa. The prostate-specific antigen (PSA) protease processes 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur