Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein FAM92A

 FA92A_HUMAN             Reviewed;         289 AA.
A1XBS5; A1XBS4; Q32ND3; Q6AHW7; Q8N8R1; Q96L09;
15-MAY-2007, integrated into UniProtKB/Swiss-Prot.
23-SEP-2008, sequence version 2.
27-SEP-2017, entry version 87.
RecName: Full=Protein FAM92A;
Name=FAM92A {ECO:0000312|HGNC:HGNC:30452}; Synonyms=FAM92A1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), AND SUBCELLULAR
LOCATION (ISOFORM 3).
PubMed=17646714;
Ruan X.Z., Yan F., Zhao X.Y., Wang C.T., Song M., Yang H.S.,
Deng H.X., Wei Y.Q.;
"Identification and characterization of two novel variants of the
DUF1208 protein FAM92A1.";
Mol. Cells 23:391-397(2007).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
TISSUE=Brain;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Testis, and Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
INTERACTION WITH CBY1, SUBCELLULAR LOCATION, FUNCTION, SUBUNIT, AND
MUTAGENESIS OF LYS-107; ARG-110; LYS-114; ARG-132; ARG-134 AND
ARG-136.
PubMed=27528616; DOI=10.1128/MCB.00160-16;
Li F.Q., Chen X., Fisher C., Siller S.S., Zelikman K., Kuriyama R.,
Takemaru K.I.;
"BAR domain-containing FAM92 proteins interact with chibby1 to
facilitate ciliogenesis.";
Mol. Cell. Biol. 36:2668-2680(2016).
-!- FUNCTION: May play a role in ciliogenesis (PubMed:27528616). In
cooperation with CBY1 may facilitate ciliogenesis likely by the
recruitment and fusion of endosomal vesicles at distal appendages
during early stages of ciliogenesis (PubMed:27528616).
{ECO:0000269|PubMed:27528616}.
-!- SUBUNIT: Homodimer (via BAR-like domain) (PubMed:27528616).
Heterodimer with FAM92B (via BAR-like domains) (PubMed:27528616).
Interacts (via BAR-like domain) with CBY1; this interaction is
required for targeting FAM92A to centriole (PubMed:27528616).
{ECO:0000269|PubMed:27528616}.
-!- INTERACTION:
Q9Y3M2:CBY1; NbExp=3; IntAct=EBI-2349888, EBI-947308;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:27528616}.
Cytoplasm, cytoskeleton, microtubule organizing center,
centrosome, centriole {ECO:0000269|PubMed:27528616}. Cytoplasm,
cytoskeleton, cilium basal body {ECO:0000269|PubMed:27528616}.
Note=Weak punctate vesicular distribution throughout the cytoplasm
(PubMed:27528616). Localizes at the distal end of mother
centrioles (PubMed:27528616). Extensive colocalization with CBY1
at mother centrioles (PubMed:27528616).
{ECO:0000269|PubMed:27528616}.
-!- SUBCELLULAR LOCATION: Isoform 3: Nucleus
{ECO:0000269|PubMed:17646714}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1; Synonyms=FAM92A1-289 {ECO:0000303|PubMed:17646714};
IsoId=A1XBS5-1; Sequence=Displayed;
Name=2; Synonyms=FAM92A1-251 {ECO:0000303|PubMed:17646714};
IsoId=A1XBS5-2; Sequence=VSP_025294;
Name=3;
IsoId=A1XBS5-3; Sequence=VSP_025296;
Name=4;
IsoId=A1XBS5-4; Sequence=VSP_025295;
Note=No experimental confirmation available.;
Name=5;
IsoId=A1XBS5-5; Sequence=VSP_025292, VSP_025293;
Note=No experimental confirmation available.;
-!- DOMAIN: The BAR-like domain displays limited similarity to other
BAR domains. {ECO:0000305|PubMed:27528616}.
-!- SIMILARITY: Belongs to the FAM92 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH14598.2; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AAI08708.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; DQ327715; ABC55436.1; -; mRNA.
EMBL; DQ327716; ABC55437.1; -; mRNA.
EMBL; AK096298; BAC04753.1; -; mRNA.
EMBL; CR627475; CAH10675.1; -; mRNA.
EMBL; AC010834; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC120053; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC014598; AAH14598.2; ALT_INIT; mRNA.
EMBL; BC108707; AAI08708.1; ALT_INIT; mRNA.
CCDS; CCDS47892.1; -. [A1XBS5-1]
CCDS; CCDS64933.1; -. [A1XBS5-2]
RefSeq; NP_001269963.1; NM_001283034.1. [A1XBS5-2]
RefSeq; NP_660312.2; NM_145269.4. [A1XBS5-1]
UniGene; Hs.125038; -.
ProteinModelPortal; A1XBS5; -.
SMR; A1XBS5; -.
BioGrid; 126476; 5.
IntAct; A1XBS5; 3.
iPTMnet; A1XBS5; -.
PhosphoSitePlus; A1XBS5; -.
BioMuta; FAM92A1; -.
EPD; A1XBS5; -.
MaxQB; A1XBS5; -.
PaxDb; A1XBS5; -.
PRIDE; A1XBS5; -.
DNASU; 137392; -.
Ensembl; ENST00000423990; ENSP00000401774; ENSG00000188343. [A1XBS5-2]
Ensembl; ENST00000452913; ENSP00000391671; ENSG00000188343. [A1XBS5-3]
Ensembl; ENST00000518116; ENSP00000428065; ENSG00000188343. [A1XBS5-4]
Ensembl; ENST00000518322; ENSP00000429367; ENSG00000188343. [A1XBS5-1]
GeneID; 137392; -.
KEGG; hsa:137392; -.
UCSC; uc064onr.1; human. [A1XBS5-1]
CTD; 137392; -.
DisGeNET; 137392; -.
EuPathDB; HostDB:ENSG00000188343.12; -.
GeneCards; FAM92A1; -.
H-InvDB; HIX0007647; -.
H-InvDB; HIX0024596; -.
HGNC; HGNC:30452; FAM92A.
HPA; HPA034760; -.
MIM; 617273; gene.
neXtProt; NX_A1XBS5; -.
OpenTargets; ENSG00000188343; -.
PharmGKB; PA142671823; -.
eggNOG; ENOG410IHVX; Eukaryota.
eggNOG; ENOG410Z4I5; LUCA.
GeneTree; ENSGT00390000010285; -.
HOGENOM; HOG000060253; -.
HOVERGEN; HBG107895; -.
InParanoid; A1XBS5; -.
OMA; FILISMK; -.
OrthoDB; EOG091G0T7H; -.
PhylomeDB; A1XBS5; -.
TreeFam; TF324316; -.
ChiTaRS; FAM92A1; human.
GenomeRNAi; 137392; -.
PRO; PR:A1XBS5; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000188343; -.
CleanEx; HS_FAM92A1; -.
ExpressionAtlas; A1XBS5; baseline and differential.
Genevisible; A1XBS5; HS.
GO; GO:0005814; C:centriole; IDA:UniProtKB.
GO; GO:0036064; C:ciliary basal body; IEA:Ensembl.
GO; GO:0097546; C:ciliary base; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0060271; P:cilium assembly; IMP:UniProtKB.
CDD; cd07598; BAR_FAM92; 1.
InterPro; IPR027267; AH/BAR-dom.
InterPro; IPR035590; BAR_FAM92.
InterPro; IPR009602; FAM92.
PANTHER; PTHR21223; PTHR21223; 1.
Pfam; PF06730; FAM92; 1.
SUPFAM; SSF103657; SSF103657; 1.
1: Evidence at protein level;
Alternative splicing; Cell projection; Cilium biogenesis/degradation;
Coiled coil; Complete proteome; Cytoplasm; Cytoskeleton; Nucleus;
Polymorphism; Reference proteome.
CHAIN 1 289 Protein FAM92A.
/FTId=PRO_0000287080.
REGION 10 220 BAR-like. {ECO:0000305|PubMed:27528616}.
COILED 107 178 {ECO:0000255}.
VAR_SEQ 89 97 ERLEAKVVE -> WSEITVSLL (in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_025292.
VAR_SEQ 98 289 Missing (in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_025293.
VAR_SEQ 182 219 Missing (in isoform 2).
{ECO:0000303|PubMed:17646714}.
/FTId=VSP_025294.
VAR_SEQ 220 289 VFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQV
STCRLRKDQQAEDDEDDELDVTEEENFLK -> RWSFAMLP
RLVLNSWGSSDPPALASQSVRFSEILCMHQIIHLV (in
isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_025295.
VAR_SEQ 260 289 VSTCRLRKDQQAEDDEDDELDVTEEENFLK -> EAGWAAT
CQTLI (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_025296.
VARIANT 222 222 R -> Q (in dbSNP:rs36117362).
/FTId=VAR_062190.
MUTAGEN 107 107 K->E: Abolishes ability to induce
membrane remodeling in the presence of
CBY1; when associated with E-110; E-114;
E-132; E-134 and E-136.
{ECO:0000269|PubMed:27528616}.
MUTAGEN 110 110 R->E: Abolishes ability to induce
membrane remodeling in the presence of
CBY1; when associated with E-107;E-114;
E-132; E-134 and E-136.
{ECO:0000269|PubMed:27528616}.
MUTAGEN 114 114 K->E: Abolishes ability to induce
membrane remodeling in the presence of
CBY1; when associated with E-107; E-110;
E-132; E-134 and E-136.
{ECO:0000269|PubMed:27528616}.
MUTAGEN 132 132 R->E: Abolishes ability to induce
membrane remodeling in the presence of
CBY1; when associated with E-107; E-110;
E-114; E-134 and E-136.
{ECO:0000269|PubMed:27528616}.
MUTAGEN 134 134 R->E: Abolishes ability to induce
membrane remodeling in the presence of
CBY1; when associated with E-107; E-110;
E-114; E-132 and E-136.
{ECO:0000269|PubMed:27528616}.
MUTAGEN 136 136 R->E: Abolishes ability to induce
membrane remodeling in the presence of
CBY1; when associated with E-107; E-110;
E-114; E-132 and E-134.
{ECO:0000269|PubMed:27528616}.
CONFLICT 137 137 N -> S (in Ref. 1; ABC55436).
{ECO:0000305}.
CONFLICT 150 150 E -> G (in Ref. 2; BAC04753).
{ECO:0000305}.
CONFLICT 281 281 V -> I (in Ref. 1; ABC55437).
{ECO:0000305}.
SEQUENCE 289 AA; 33431 MW; CC95F1A4217FDCA5 CRC64;
MMRRTLENRN AQTKQLQTAV SNVEKHFGEL CQIFAAYVRK TARLRDKADL LVNEINAYAA
TETPHLKLGL MNFADEFAKL QDYRQAEVER LEAKVVEPLK TYGTIVKMKR DDLKATLTAR
NREAKQLTQL ERTRQRNPSD RHVISQAETE LQRAAMDASR TSRHLEETIN NFERQKMKDI
KTIFSEFITI EMLFHGKALE VYTAAYQNIQ NIDEDEDLEV FRNSLYAPDY SSRLDIVRAN
SKSPLQRSLS AKCVSGTGQV STCRLRKDQQ AEDDEDDELD VTEEENFLK


Related products :

Catalog number Product name Quantity
EIAAB14045 Fam92a,Fam92a1,Mouse,Mus musculus,Protein FAM92A1
032409A Fam92a 250ul
PAH-G1-2 Protein Arrays containing 234 Human Protein for simultaneous detection of Protein function, including Protein-protein interaction, Protein modification, antibody specificity, auto-antibody and small m 1 glass slide with 2 sub-arrays
29-844 RNF40 contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the 0.1 mg
29-850 The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this 0.1 mg
EIAAB44668 Dap12,DNAX-activation protein 12,Karap,KAR-associated protein,Killer-activating receptor-associated protein,Mouse,Mus musculus,TYRO protein tyrosine kinase-binding protein,Tyrobp
EIAAB10617 DCN1-like protein 1,DCUN1 domain-containing protein 1,Dcun1d1,Dcun1l1,Defective in cullin neddylation protein 1-like protein 1,Mouse,Mus musculus,Rp42,Tes3,Testis-specific protein 3
EIAAB44667 DAP12,DNAX-activation protein 12,Homo sapiens,Human,KARAP,KAR-associated protein,Killer-activating receptor-associated protein,TYRO protein tyrosine kinase-binding protein,TYROBP
18-003-43520 HSPB1-associated protein 1 - 27 KdA heat shock protein-associated protein 1; Protein associated with small stress protein 1 Polyclonal 0.05 mg Aff Pur
EIAAB25665 AML1T1,CBFA2T1,CDR,Cyclin-D-related protein,Eight twenty one protein,ETO,Homo sapiens,Human,MTG8,Protein CBFA2T1,Protein ETO,Protein MTG8,RUNX1T1,Zinc finger MYND domain-containing protein 2,ZMYND2
EIAAB46018 C6orf55,Dopamine-responsive gene 1 protein,DRG-1,Homo sapiens,HSPC228,Human,LIP5,LYST-interacting protein 5,My012,SBP1,SKD1-binding protein 1,Vacuolar protein sorting-associated protein VTA1 homolog,V
18-003-43690 Guanine nucleotide-binding protein subunit beta-like protein 1 - G protein subunit beta-like protein 1; WD40 repeat-containing protein deleted in VCFS; Protein WDVCF; WD repeat-containing protein 14; 0.1 mg Protein A
E1773h ELISA kit G-CSF-induced gene 1 protein,GIG1,GIG-1 protein,GMP-17,Granule membrane protein of 17 kDa,Homo sapiens,Human,Natural killer cell protein 7,NKG7,p15-TIA-1,Protein NKG7 96T
U1773h CLIA G-CSF-induced gene 1 protein,GIG1,GIG-1 protein,GMP-17,Granule membrane protein of 17 kDa,Homo sapiens,Human,Natural killer cell protein 7,NKG7,p15-TIA-1,Protein NKG7 96T
EIAAB32247 ADP-ribosylation factor-like protein 6-interacting protein 5,Aip-5,ARL-6-interacting protein 5,ARL6IP5,Cytoskeleton-related vitamin A-responsive protein,Dermal papilla-derived protein 11,DERP11,Glutam
E1773h ELISA G-CSF-induced gene 1 protein,GIG1,GIG-1 protein,GMP-17,Granule membrane protein of 17 kDa,Homo sapiens,Human,Natural killer cell protein 7,NKG7,p15-TIA-1,Protein NKG7 96T
EIAAB31034 Androgen receptor-interacting protein 3,ARIP3,DAB2-interacting protein,DIP,E3 SUMO-protein ligase PIAS2,Homo sapiens,Human,Miz1,Msx-interacting zinc finger protein,PIAS2,PIAS-NY protein,PIASX,Protein
EIAAB29586 Mouse,Mus musculus,p53-induced gene 11 protein,Pig11,Tp53i11,Transformation related protein 53 inducible protein 11,Trp53i11,Tumor protein p53-inducible protein 11
EIAAB43486 Mouse,Mus musculus,Protein TAP1,Protein TRUSS,Rabex-5_Rin2-interacting protein,Short transient receptor potential channel 4-associated protein,TNF-receptor ubiquitous scaffolding_signaling protein,Trp
10-663-45493 Heat Shock Protein 22kD (HSP22) Human - HspB8; Alpha crystallin C chain; Small stress protein-like protein HSP22; E2-induced gene 1 protein; Protein kinase H11 N_A 0.002 mg
EIAAB38162 Homo sapiens,Human,MAP,Merlin-associated protein,RabGAPLP,RABGAPLP,Rab-GTPase-activating protein-like protein,RUN and TBC1 domain-containing protein 3,RUTBC3,SGSM3,Small G protein signaling modulator
10-663-45493 Heat Shock Protein 22kD (HSP22) Human - HspB8; Alpha crystallin C chain; Small stress protein-like protein HSP22; E2-induced gene 1 protein; Protein kinase H11 N_A 0.01 mg
EIAAB43485 C20orf188,Homo sapiens,Human,Protein TAP1,Protein TRUSS,Short transient receptor potential channel 4-associated protein,TNF-receptor ubiquitous scaffolding_signaling protein,Trp4-associated protein,TR
EIAAB33912 E3 ubiquitin-protein ligase RBBP6,Mouse,Mus musculus,P2pr,p53-associated cellular protein of testis,Pact,Proliferation potential-related protein,Protein P2P-R,Rbbp6,Retinoblastoma-binding protein 6
10-663-45493 Heat Shock Protein 22kD (HSP22) Human - HspB8; Alpha crystallin C chain; Small stress protein-like protein HSP22; E2-induced gene 1 protein; Protein kinase H11 N_A 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur