Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein MID1-COMPLEMENTING ACTIVITY 2

 MCAC2_ARATH             Reviewed;         416 AA.
Q3EBY6; A2PYH1; Q2V480; Q2V481; Q2V482;
03-MAY-2011, integrated into UniProtKB/Swiss-Prot.
08-NOV-2005, sequence version 1.
12-SEP-2018, entry version 80.
RecName: Full=Protein MID1-COMPLEMENTING ACTIVITY 2;
Name=MCA2; OrderedLocusNames=At2g17780; ORFNames=T17A5.4;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=17360695; DOI=10.1073/pnas.0607703104;
Nakagawa Y., Katagiri T., Shinozaki K., Qi Z., Tatsumi H.,
Furuichi T., Kishigami A., Sokabe M., Kojima I., Sato S., Kato T.,
Tabata S., Iida K., Terashima A., Nakano M., Ikeda M., Yamanaka T.,
Iida H.;
"Arabidopsis plasma membrane protein crucial for Ca2+ influx and touch
sensing in roots.";
Proc. Natl. Acad. Sci. U.S.A. 104:3639-3644(2007).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617197; DOI=10.1038/45471;
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D.,
Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V.,
Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L.,
Moffat K.S., Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L.,
Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H.,
Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D.,
Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M.,
Venter J.C.;
"Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana.";
Nature 402:761-768(1999).
[3]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[4]
FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, ACTIVITY
REGULATION, AND DISRUPTION PHENOTYPE.
PubMed=20097794; DOI=10.1104/pp.109.147371;
Yamanaka T., Nakagawa Y., Mori K., Nakano M., Imamura T., Kataoka H.,
Terashima A., Iida K., Kojima I., Katagiri T., Shinozaki K., Iida H.;
"MCA1 and MCA2 that mediate Ca2+ uptake have distinct and overlapping
roles in Arabidopsis.";
Plant Physiol. 152:1284-1296(2010).
-!- FUNCTION: Calcium-permeable stretch-activated channel component.
Probably involved in mechanosensing and in mechano-stimulated
calcium uptake mechanism. {ECO:0000269|PubMed:20097794}.
-!- ACTIVITY REGULATION: Inhibited by GdCl(3), but not by verapamil.
{ECO:0000269|PubMed:20097794}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:20097794};
Single-pass membrane protein {ECO:0000269|PubMed:20097794}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q3EBY6-1; Sequence=Displayed;
Name=2;
IsoId=Q3EBY6-2; Sequence=VSP_040966;
Note=Derived from EST data. No experimental confirmation
available.;
Name=3;
IsoId=Q3EBY6-3; Sequence=VSP_040967;
Note=Derived from EST data. No experimental confirmation
available.;
Name=4;
IsoId=Q3EBY6-4; Sequence=VSP_040965;
Note=Derived from EST data. No experimental confirmation
available.;
-!- TISSUE SPECIFICITY: Expressed in roots, leaves, stems, flowers and
siliques. In the root, high levels of expression in vascular
tissues, in the stele and endodermis, but no expression in the
cortex, epidermis, root cap, promeristem and adjacent elongation
zone of the primary root. Not expressed in root hairs. Detected in
shoot apical meristem, leaf mesophyll cells and vascular tissues,
upper half of inflorescence, but not in petioles of rosette
leaves. {ECO:0000269|PubMed:20097794}.
-!- DISRUPTION PHENOTYPE: No visible phenotype when grown under normal
conditions, due to redundancy with MCA1. The roots are able to
normally sense the hardness of the growth medium. Mca1 and mca2
double mutant shows a strong growth defect.
{ECO:0000269|PubMed:20097794}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB196961; BAF46390.1; -; mRNA.
EMBL; CP002685; AEC06682.1; -; Genomic_DNA.
EMBL; CP002685; AEC06683.1; -; Genomic_DNA.
EMBL; CP002685; AEC06684.1; -; Genomic_DNA.
EMBL; CP002685; AEC06685.1; -; Genomic_DNA.
EMBL; CP002685; ANM62012.1; -; Genomic_DNA.
EMBL; CP002685; ANM62013.1; -; Genomic_DNA.
EMBL; CP002685; ANM62015.1; -; Genomic_DNA.
EMBL; CP002685; ANM62016.1; -; Genomic_DNA.
EMBL; CP002685; ANM62017.1; -; Genomic_DNA.
RefSeq; NP_001031366.1; NM_001036289.1. [Q3EBY6-2]
RefSeq; NP_001031367.1; NM_001036290.2. [Q3EBY6-3]
RefSeq; NP_001031368.1; NM_001036291.1. [Q3EBY6-4]
RefSeq; NP_001324195.1; NM_001335561.1. [Q3EBY6-3]
RefSeq; NP_001324196.1; NM_001335556.1. [Q3EBY6-1]
RefSeq; NP_001324198.1; NM_001335557.1. [Q3EBY6-1]
RefSeq; NP_001324199.1; NM_001335558.1. [Q3EBY6-1]
RefSeq; NP_001324200.1; NM_001335559.1. [Q3EBY6-1]
RefSeq; NP_179369.2; NM_127332.3. [Q3EBY6-1]
UniGene; At.40099; -.
ProteinModelPortal; Q3EBY6; -.
SMR; Q3EBY6; -.
STRING; 3702.AT2G17780.1; -.
TCDB; 1.A.87.1.2; the mechanosensitive calcium channel (mca) family.
PaxDb; Q3EBY6; -.
PRIDE; Q3EBY6; -.
EnsemblPlants; AT2G17780.1; AT2G17780.1; AT2G17780. [Q3EBY6-1]
EnsemblPlants; AT2G17780.10; AT2G17780.10; AT2G17780. [Q3EBY6-1]
EnsemblPlants; AT2G17780.2; AT2G17780.2; AT2G17780. [Q3EBY6-2]
EnsemblPlants; AT2G17780.3; AT2G17780.3; AT2G17780. [Q3EBY6-3]
EnsemblPlants; AT2G17780.4; AT2G17780.4; AT2G17780. [Q3EBY6-4]
EnsemblPlants; AT2G17780.5; AT2G17780.5; AT2G17780. [Q3EBY6-1]
EnsemblPlants; AT2G17780.6; AT2G17780.6; AT2G17780. [Q3EBY6-1]
EnsemblPlants; AT2G17780.7; AT2G17780.7; AT2G17780. [Q3EBY6-1]
EnsemblPlants; AT2G17780.9; AT2G17780.9; AT2G17780. [Q3EBY6-3]
GeneID; 816287; -.
Gramene; AT2G17780.1; AT2G17780.1; AT2G17780. [Q3EBY6-1]
Gramene; AT2G17780.10; AT2G17780.10; AT2G17780. [Q3EBY6-1]
Gramene; AT2G17780.2; AT2G17780.2; AT2G17780. [Q3EBY6-2]
Gramene; AT2G17780.3; AT2G17780.3; AT2G17780. [Q3EBY6-3]
Gramene; AT2G17780.4; AT2G17780.4; AT2G17780. [Q3EBY6-4]
Gramene; AT2G17780.5; AT2G17780.5; AT2G17780. [Q3EBY6-1]
Gramene; AT2G17780.6; AT2G17780.6; AT2G17780. [Q3EBY6-1]
Gramene; AT2G17780.7; AT2G17780.7; AT2G17780. [Q3EBY6-1]
Gramene; AT2G17780.9; AT2G17780.9; AT2G17780. [Q3EBY6-3]
KEGG; ath:AT2G17780; -.
Araport; AT2G17780; -.
TAIR; locus:2827953; AT2G17780.
HOGENOM; HOG000030376; -.
InParanoid; Q3EBY6; -.
OMA; SEACSEL; -.
OrthoDB; EOG09360CNE; -.
PhylomeDB; Q3EBY6; -.
PRO; PR:Q3EBY6; -.
Proteomes; UP000006548; Chromosome 2.
ExpressionAtlas; Q3EBY6; baseline and differential.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IDA:TAIR.
GO; GO:0005262; F:calcium channel activity; IDA:TAIR.
GO; GO:0007166; P:cell surface receptor signaling pathway; IEA:InterPro.
GO; GO:0048528; P:post-embryonic root development; IGI:TAIR.
Gene3D; 1.20.930.20; -; 1.
InterPro; IPR036537; Adaptor_Cbl_N_dom_sf.
InterPro; IPR006461; PLAC_motif_containing.
Pfam; PF04749; PLAC8; 1.
TIGRFAMs; TIGR01571; A_thal_Cys_rich; 1.
2: Evidence at transcript level;
Alternative splicing; Cell membrane; Coiled coil; Complete proteome;
Membrane; Reference proteome; Transmembrane; Transmembrane helix.
CHAIN 1 416 Protein MID1-COMPLEMENTING ACTIVITY 2.
/FTId=PRO_0000407742.
TRANSMEM 338 354 Helical. {ECO:0000255}.
COILED 191 219 {ECO:0000255}.
COMPBIAS 347 381 Cys-rich.
VAR_SEQ 307 416 LKTLFFPCGTLAKISTVATSRQISSTEVCKNLIVYSLILSC
CCYTCCIRKKLRKTLNITGGCIDDFLSHLMCCCCALVQELR
EVEIHRASYGTEKSNKEMSPPTPQFMEE -> KPSHSVFI
(in isoform 4). {ECO:0000305}.
/FTId=VSP_040965.
VAR_SEQ 398 399 Missing (in isoform 2). {ECO:0000305}.
/FTId=VSP_040966.
VAR_SEQ 399 416 TEKSNKEMSPPTPQFMEE -> KIYTFTDILTYF (in
isoform 3). {ECO:0000305}.
/FTId=VSP_040967.
SEQUENCE 416 AA; 47414 MW; 1D9F308788EA9F42 CRC64;
MANSWDQLGE IASVAQLTGI DALKLIGMIV NAANTARMHK KNCRQFAHHL KLIRNLLEQI
KNSEMNQRSE ILEPLQGLDD ALRRSYILVK SCQEKSYLYL LAMGWNIVNQ FEKAQNEIDL
FLKIVPLINM ADNARIRERL EAIERDQREY TLDEEDRKVQ DVILKQESTR EAATSVLKKT
LSRSYPNMGF CEALKTEEEK LQLELQRSRA RYDADQCEVI QRLIDVTQTA ATVEPNLEKV
LTKKEELTSS KKRDDLYDTD SSSIRADSRS TSYVSSGHEL LSGRSLQHRG NWHADLLDCC
SEPCLCLKTL FFPCGTLAKI STVATSRQIS STEVCKNLIV YSLILSCCCY TCCIRKKLRK
TLNITGGCID DFLSHLMCCC CALVQELREV EIHRASYGTE KSNKEMSPPT PQFMEE


Related products :

Catalog number Product name Quantity
EIAAB46539 DNA repair protein complementing XP-A cells,Homo sapiens,Human,Xeroderma pigmentosum group A-complementing protein,XPA,XPAC
EIAAB46541 DNA repair protein complementing XP-C cells,Homo sapiens,Human,p125,Xeroderma pigmentosum group C-complementing protein,XPC,XPCC
EIAAB13182 DNA excision repair protein ERCC-5,DNA repair protein complementing XP-G cells,ERCC5,ERCM2,Homo sapiens,Human,Xeroderma pigmentosum group G-complementing protein,XPG,XPGC
EIAAB46542 DNA excision repair protein ERCC-4,DNA repair endonuclease XPF,DNA repair protein complementing XP-F cells,ERCC11,ERCC4,Homo sapiens,Human,Xeroderma pigmentosum group F-complementing protein,XPF
EIAAB46538 DNA repair protein complementing XP-A cells homolog,Mouse,Mus musculus,Xeroderma pigmentosum group A-complementing protein homolog,Xpa,Xpac
EIAAB46540 DNA repair protein complementing XP-C cells homolog,Mouse,Mus musculus,p125,Xeroderma pigmentosum group C-complementing protein homolog,Xpc
20-272-191522 XPF - Mouse monoclonal [SPM228] to XPF; EC 3.1.-.-; DNA excision repair protein ERCC-4; DNA-repair protein complementing XP-F cells; Xeroderma pigmentosum group F-complementing protein Monoclonal 0.5 ml
DL-MID1-Mu Mouse Midline 1 (MID1) ELISA Kit 96T
EIAAB46537 Chicken,DNA repair protein complementing XP-A cells homolog,Gallus gallus,Xeroderma pigmentosum group A-complementing protein homolog,XPA,XPAC
EIAAB13183 DNA excision repair protein ERCC-5,DNA repair protein complementing XP-G cells homolog,Ercc5,Ercc-5,Mouse,Mus musculus,Xeroderma pigmentosum group G-complementing protein homolog,Xpg
30-276 GDE1 has glycerophosphoinositol phosphodiesterase activity. It has little or no activity towards glycerophosphocholine. GDE1 activity can be modulated by G-protein signaling pathways. 0.05 mg
EIAAB33735 Calcitonin-receptor-like receptor activity-modifying protein 3,CRLR activity-modifying protein 3,Homo sapiens,Human,RAMP3,Receptor activity-modifying protein 3
EIAAB33730 Calcitonin-receptor-like receptor activity-modifying protein 2,CRLR activity-modifying protein 2,Homo sapiens,Human,RAMP2,Receptor activity-modifying protein 2
EIAAB33727 Calcitonin-receptor-like receptor activity-modifying protein 1,CRLR activity-modifying protein 1,Homo sapiens,Human,RAMP1,Receptor activity-modifying protein 1
26-582 DCLRE1C is a nuclear protein that is involved in V (D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity; it also exhibits endonuclease activity on 5' an 0.05 mg
26-583 DCLRE1C is a nuclear protein that is involved in V (D)J recombination and DNA repair. The protein has single-strand-specific 5'-3' exonuclease activity; it also exhibits endonuclease activity on 5' an 0.05 mg
26-900 FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for mainten 0.05 mg
DL-MID1-Mu MID1 ELISA kit 96T
27-178 The function of this protein is binding , oxidoreductase activity ,and transcription repressor activity. 0.05 mg
DT1001 Human tPA Activity & ELISA Duro Kit (Measure activity & protein concentration in one assay) 96 well plate
26-641 GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which 0.05 mg
orb74267 MID1 interacting G12 like protein antibody 100 ul
orb41301 MID1 interacting G12 like protein antibody 100 ul
H00004281-Q01-25 MID1 (Human) Recombinant Protein (Q01) 25 ug
CSB-EL013820RA Rat Mid1-interacting protein 1(MID1IP1) ELISA kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur