Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein SGE1 (10-N-nonyl acridine orange resistance protein) (Crystal violet resistance protein)

 SGE1_YEAST              Reviewed;         543 AA.
P33335; D6W4J6; Q05720;
01-FEB-1994, integrated into UniProtKB/Swiss-Prot.
01-FEB-1994, sequence version 1.
31-JAN-2018, entry version 136.
RecName: Full=Protein SGE1;
AltName: Full=10-N-nonyl acridine orange resistance protein;
AltName: Full=Crystal violet resistance protein;
Name=SGE1; Synonyms=NOR1; OrderedLocusNames=YPR198W; ORFNames=P9677.3;
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
NCBI_TaxID=559292;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=8349103;
Amakasu H., Suzuki Y., Nishizawa M., Fukasawa T.;
"Isolation and characterization of SGE1: a yeast gene that partially
suppresses the gal11 mutation in multiple copies.";
Genetics 134:675-683(1993).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
STRAIN=ATCC 204508 / S288c;
PubMed=8058039; DOI=10.1007/BF00285456;
Ehrenhofer-Murray A.E., Wuergler F.E., Sengstag C.;
"The Saccharomyces cerevisiae SGE1 gene product: a novel drug-
resistance protein within the major facilitator superfamily.";
Mol. Gen. Genet. 244:287-294(1994).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
STRAIN=ATCC 28383 / FL100 / VTT C-80102;
Urdaci M.C., Jacquot C.;
"Membrane protein confering resistance to drug.";
Submitted (OCT-1993) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=9271105;
DOI=10.1002/(SICI)1097-0061(199708)13:10<891::AID-YEA138>3.0.CO;2-U;
Jacquot C., Julien R., Guilloton M.;
"The Saccharomyces cerevisiae MFS superfamily SGE1 gene confers
resistance to cationic dyes.";
Yeast 13:891-902(1997).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=ATCC 204508 / S288c;
PubMed=9169875;
Bussey H., Storms R.K., Ahmed A., Albermann K., Allen E., Ansorge W.,
Araujo R., Aparicio A., Barrell B.G., Badcock K., Benes V.,
Botstein D., Bowman S., Brueckner M., Carpenter J., Cherry J.M.,
Chung E., Churcher C.M., Coster F., Davis K., Davis R.W.,
Dietrich F.S., Delius H., DiPaolo T., Dubois E., Duesterhoeft A.,
Duncan M., Floeth M., Fortin N., Friesen J.D., Fritz C., Goffeau A.,
Hall J., Hebling U., Heumann K., Hilbert H., Hillier L.W.,
Hunicke-Smith S., Hyman R.W., Johnston M., Kalman S., Kleine K.,
Komp C., Kurdi O., Lashkari D., Lew H., Lin A., Lin D., Louis E.J.,
Marathe R., Messenguy F., Mewes H.-W., Mirtipati S., Moestl D.,
Mueller-Auer S., Namath A., Nentwich U., Oefner P., Pearson D.,
Petel F.X., Pohl T.M., Purnelle B., Rajandream M.A., Rechmann S.,
Rieger M., Riles L., Roberts D., Schaefer M., Scharfe M., Scherens B.,
Schramm S., Schroeder M., Sdicu A.-M., Tettelin H., Urrestarazu L.A.,
Ushinsky S., Vierendeels F., Vissers S., Voss H., Walsh S.V.,
Wambutt R., Wang Y., Wedler E., Wedler H., Winnett E., Zhong W.-W.,
Zollner A., Vo D.H., Hani J.;
"The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.";
Nature 387:103-105(1997).
[6]
GENOME REANNOTATION.
STRAIN=ATCC 204508 / S288c;
PubMed=24374639; DOI=10.1534/g3.113.008995;
Engel S.R., Dietrich F.S., Fisk D.G., Binkley G., Balakrishnan R.,
Costanzo M.C., Dwight S.S., Hitz B.C., Karra K., Nash R.S., Weng S.,
Wong E.D., Lloyd P., Skrzypek M.S., Miyasato S.R., Simison M.,
Cherry J.M.;
"The reference genome sequence of Saccharomyces cerevisiae: Then and
now.";
G3 (Bethesda) 4:389-398(2014).
[7]
CHARACTERIZATION.
PubMed=9483795;
DOI=10.1002/(SICI)1097-0061(19980115)14:1<49::AID-YEA199>3.0.CO;2-T;
Ehrenhofer-Murray A.E., Keller Seitz M.U., Sengstag C.;
"The Sge1 protein of Saccharomyces cerevisiae is a membrane-associated
multidrug transporter.";
Yeast 14:49-65(1998).
[8]
TOPOLOGY [LARGE SCALE ANALYSIS].
STRAIN=ATCC 208353 / W303-1A;
PubMed=16847258; DOI=10.1073/pnas.0604075103;
Kim H., Melen K., Oesterberg M., von Heijne G.;
"A global topology map of the Saccharomyces cerevisiae membrane
proteome.";
Proc. Natl. Acad. Sci. U.S.A. 103:11142-11147(2006).
-!- FUNCTION: Drug export permease. Multi-copy suppressor of loss-of-
function mutation of GAL11. Involved specifically in transcription
of GAL4-dependent genes. Can link GAL4 with the basal
transcription machinery if GAL11 is missing. Confers resistance to
10-N-nonyl acridine orange (NAO) and in general to cationic dyes.
-!- SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.
-!- SIMILARITY: Belongs to the major facilitator superfamily.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L11640; AAA35043.1; -; Genomic_DNA.
EMBL; U02077; AAA52190.1; -; Genomic_DNA.
EMBL; L24961; AAA65606.1; -; Genomic_DNA.
EMBL; X77765; CAA54805.1; -; Genomic_DNA.
EMBL; U25841; AAB64626.1; -; Genomic_DNA.
EMBL; BK006949; DAA11612.1; -; Genomic_DNA.
PIR; S40888; S40888.
RefSeq; NP_015524.1; NM_001184295.1.
ProteinModelPortal; P33335; -.
BioGrid; 36368; 68.
DIP; DIP-7575N; -.
IntAct; P33335; 3.
MINT; MINT-1363018; -.
STRING; 4932.YPR198W; -.
TCDB; 2.A.1.3.54; the major facilitator superfamily (mfs).
MaxQB; P33335; -.
PaxDb; P33335; -.
PRIDE; P33335; -.
EnsemblFungi; YPR198W; YPR198W; YPR198W.
GeneID; 856327; -.
KEGG; sce:YPR198W; -.
EuPathDB; FungiDB:YPR198W; -.
SGD; S000006402; SGE1.
GeneTree; ENSGT00390000006559; -.
HOGENOM; HOG000247960; -.
InParanoid; P33335; -.
OMA; IILVSCC; -.
OrthoDB; EOG092C1LCH; -.
BioCyc; YEAST:G3O-34318-MONOMER; -.
PRO; PR:P33335; -.
Proteomes; UP000002311; Chromosome XVI.
GO; GO:0005887; C:integral component of plasma membrane; IDA:SGD.
GO; GO:0015238; F:drug transmembrane transporter activity; IMP:SGD.
GO; GO:0015893; P:drug transport; IMP:SGD.
GO; GO:0042493; P:response to drug; IMP:SGD.
CDD; cd06174; MFS; 1.
InterPro; IPR011701; MFS.
InterPro; IPR020846; MFS_dom.
InterPro; IPR036259; MFS_trans_sf.
Pfam; PF07690; MFS_1; 1.
SUPFAM; SSF103473; SSF103473; 3.
PROSITE; PS50850; MFS; 1.
1: Evidence at protein level;
Complete proteome; Membrane; Reference proteome; Transmembrane;
Transmembrane helix; Transport.
CHAIN 1 543 Protein SGE1.
/FTId=PRO_0000173422.
TOPO_DOM 1 8 Cytoplasmic. {ECO:0000255}.
TRANSMEM 9 29 Helical. {ECO:0000255}.
TOPO_DOM 30 41 Extracellular. {ECO:0000255}.
TRANSMEM 42 62 Helical. {ECO:0000255}.
TOPO_DOM 63 79 Cytoplasmic. {ECO:0000255}.
TRANSMEM 80 100 Helical. {ECO:0000255}.
TOPO_DOM 101 103 Extracellular. {ECO:0000255}.
TRANSMEM 104 124 Helical. {ECO:0000255}.
TOPO_DOM 125 131 Cytoplasmic. {ECO:0000255}.
TRANSMEM 132 152 Helical. {ECO:0000255}.
TOPO_DOM 153 162 Extracellular. {ECO:0000255}.
TRANSMEM 163 183 Helical. {ECO:0000255}.
TOPO_DOM 184 227 Cytoplasmic. {ECO:0000255}.
TRANSMEM 228 248 Helical. {ECO:0000255}.
TOPO_DOM 249 255 Extracellular. {ECO:0000255}.
TRANSMEM 256 276 Helical. {ECO:0000255}.
TOPO_DOM 277 300 Cytoplasmic. {ECO:0000255}.
TRANSMEM 301 321 Helical. {ECO:0000255}.
TOPO_DOM 322 341 Extracellular. {ECO:0000255}.
TRANSMEM 342 362 Helical. {ECO:0000255}.
TOPO_DOM 363 373 Cytoplasmic. {ECO:0000255}.
TRANSMEM 374 394 Helical. {ECO:0000255}.
TOPO_DOM 395 399 Extracellular. {ECO:0000255}.
TRANSMEM 400 420 Helical. {ECO:0000255}.
TOPO_DOM 421 443 Cytoplasmic. {ECO:0000255}.
TRANSMEM 444 464 Helical. {ECO:0000255}.
TOPO_DOM 465 508 Extracellular. {ECO:0000255}.
TRANSMEM 509 529 Helical. {ECO:0000255}.
TOPO_DOM 530 543 Cytoplasmic. {ECO:0000255}.
CONFLICT 429 429 D -> G (in Ref. 3; AAA65606).
{ECO:0000305}.
CONFLICT 447 486 KSLGFAFGGNMGAMIFTASLKNQMRSSQLNIPQFTSVETL
-> NPWALRLEGYGGNDIHCITQKPDALFPIKHTTIYVCRN
T (in Ref. 3; AAA65606). {ECO:0000305}.
SEQUENCE 543 AA; 59426 MW; 16A3D91DA0B950FC CRC64;
MKSTLSLTLC VISLLLTLFL AALDIVIVVT LYDTIGIKFH DFGNIGWLVT GYALSNAVFM
LLWGRLAEIL GTKECLMISV IVFEIGSLIS ALSNSMATLI SGRVVAGFGG SGIESLAFVV
GTSIVRENHR GIMITALAIS YVIAEGVGPF IGGAFNEHLS WRWCFYINLP IGAFAFIILA
FCNTSGEPHQ KMWLPSKIKK IMNYDYGELL KASFWKNTFE VLVFKLDMVG IILSSAGFTL
LMLGLSFGGN NFPWNSGIII CFFTVGPILL LLFCAYDFHF LSLSGLHYDN KRIKPLLTWN
IASNCGIFTS SITGFLSCFA YELQSAYLVQ LYQLVFKKKP TLASIHLWEL SIPAMIATMA
IAYLNSKYGI IKPAIVFGVL CGIVGSGLFT LINGELSQSI GYSILPGIAF GSIFQATLLS
SQVQITSDDP DFQNKFIEVT AFNSFAKSLG FAFGGNMGAM IFTASLKNQM RSSQLNIPQF
TSVETLLAYS TEHYDGPQSS LSKFINTAIH DVFYCALGCY ALSFFFGIFT SSKKTTISAK
KQQ


Related products :

Catalog number Product name Quantity
EIAAB25874 Influenza resistance protein,Interferon-induced GTP-binding protein Mx1,Mouse,Mus musculus,Mx1,Myxoma resistance protein 1,Myxovirus resistance protein 1
20-783-74648 MOUSE ANTI HUMAN BREAST CANCER RESISTANCE PROTEIN - Placenta-specific ATP-binding cassette transporter; Breast cancer resistance protein; Mitoxantrone resistance-associated protein; CD338 antigen; CDw 1 ml
EIAAB25876 Interferon-induced GTP-binding protein Mx1,Mx1,Myxoma resistance protein 1,Myxovirus resistance protein 1,Rat,Rattus norvegicus
EIAAB25877 Bos taurus,Bovine,Interferon-induced GTP-binding protein Mx1,MX1,Myxoma resistance protein 1,Myxovirus resistance protein 1
EIAAB25875 Interferon-induced GTP-binding protein Mx1,MX1,Myxoma resistance protein 1,Myxovirus resistance protein 1,Pig,Sus scrofa
75168-11-5 Acridine orange 10_nonyl bromide Nonyl acridine orange 1g
17504 Acridine orange 10_nonyl bromide [Nonyl acridine orange] 100 mg
17504 Acridine orange 10_nonyl bromide [Nonyl acridine orange] 100 mg
EIAAB25880 Homo sapiens,Human,Interferon-induced GTP-binding protein Mx2,Interferon-regulated resistance GTP-binding protein MxB,MX2,Myxovirus resistance protein 2,p78-related protein
EIAAB25437 ABCC6,Anthracycline resistance-associated protein,ARA,ATP-binding cassette sub-family C member 6,Homo sapiens,Human,MOAT-E,MRP6,Multidrug resistance-associated protein 6,Multi-specific organic anion t
U0960h CLIA ABCG2,ABCP,ATP-binding cassette sub-family G member 2,BCRP,BCRP1,Breast cancer resistance protein,CDw338,Homo sapiens,Human,Mitoxantrone resistance-associated protein,MXR,Placenta-specific ATP-bi 96T
E0960h ELISA ABCG2,ABCP,ATP-binding cassette sub-family G member 2,BCRP,BCRP1,Breast cancer resistance protein,CDw338,Homo sapiens,Human,Mitoxantrone resistance-associated protein,MXR,Placenta-specific ATP-b 96T
E0960h ELISA kit ABCG2,ABCP,ATP-binding cassette sub-family G member 2,BCRP,BCRP1,Breast cancer resistance protein,CDw338,Homo sapiens,Human,Mitoxantrone resistance-associated protein,MXR,Placenta-specific 96T
EIAAB25873 Canis familiaris,Canis lupus familiaris,Dog,Interferon-induced GTP-binding protein Mx1,MX1,Myxoma resistance protein 1,Myxovirus resistance protein 1
EIAAB25426 Abcc2,ATP-binding cassette sub-family C member 2,Canalicular multidrug resistance protein,Canalicular multispecific organic anion transporter 1,Cmoat,Cmrp,Mrp2,Multidrug resistance-associated protein
EIAAB25878 Homo sapiens,Human,IFI-78K,Interferon-induced GTP-binding protein Mx1,Interferon-induced protein p78,Interferon-regulated resistance GTP-binding protein MxA,MX1,Myxoma resistance protein 1,Myxovirus r
70012 NONYL ACRIDINE ORANGE (OR NAO) 50MG
70012 NONYL ACRIDINE ORANGE (OR NAO) 50 MG
22205 Nonyl acridine orange 25 mg
22205 Nonyl acridine orange 25 mg
70012 NONYL ACRIDINE ORANGE (OR NAO) 50
22205 Nonyl acridine orange *CAS 75168-11-5* 25 mg
EIAAB07980 Cisplatin resistance-related protein 9,Cleft lip and palate transmembrane protein 1-like protein,CLPTM1L,CLPTM1-like protein,CRR9,CRR9p,Homo sapiens,Human
A2110 A2350 A2450 Nonyl acridine orange *CAS 75168-11-5* 25 mg
EIAAB36333 28S ribosomal protein S29, mitochondrial,DAP3,DAP-3,Death-associated protein 3,Homo sapiens,Human,Ionizing radiation resistance conferring protein,MRPS29,MRP-S29,S29mt


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur