Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein SMG5 (EST1-like protein B) (SMG-5 homolog)

 SMG5_MOUSE              Reviewed;        1017 AA.
Q6ZPY2; Q497S2; Q8R3S4;
20-DEC-2005, integrated into UniProtKB/Swiss-Prot.
20-DEC-2005, sequence version 2.
12-SEP-2018, entry version 110.
RecName: Full=Protein SMG5;
AltName: Full=EST1-like protein B;
AltName: Full=SMG-5 homolog;
Name=Smg5; Synonyms=Est1b, Kiaa1089;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Embryonic tail;
PubMed=14621295; DOI=10.1093/dnares/10.4.167;
Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S.,
Saga Y., Nagase T., Ohara O., Koga H.;
"Prediction of the coding sequences of mouse homologues of KIAA gene:
III. The complete nucleotide sequences of 500 mouse KIAA-homologous
cDNAs identified by screening of terminal sequences of cDNA clones
randomly sampled from size-fractionated libraries.";
DNA Res. 10:167-180(2003).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), AND VARIANTS
ARG-77; LEU-166; GLU-499 AND GLY-503.
STRAIN=B5/EGFP, Czech II, and ICR;
TISSUE=Mammary tumor, and Trophoblast stem cell;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[3]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-423, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Lung, and Spleen;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: Plays a role in nonsense-mediated mRNA decay. Does not
have RNase activity by itself. Promotes dephosphorylation of UPF1.
Together with SMG7 is thought provide a link to the mRNA
degradation machinery involving exonucleolytic pathways, and to
serve as an adapter for UPF1 to protein phosphatase 2A (PP2A),
thereby triggering UPF1 dephosphorylation. Necessary for TERT
activity (By similarity). {ECO:0000250}.
-!- SUBUNIT: Interacts with TERT, PPP2CA and SMG1. Part of a complex
that contains SMG1, SMG5, SMG7, PPP2CA, a short isoform of UPF3A
(isoform UPF3AS, but not isoform UPF3AL) and phosphorylated UPF1.
Not detected in complexes that contain unphosphorylated UPF1.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus
{ECO:0000250}. Note=Detected in cytoplasmic mRNA decay bodies.
{ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q6ZPY2-1; Sequence=Displayed;
Name=2;
IsoId=Q6ZPY2-2; Sequence=VSP_016590, VSP_016591;
-!- SEQUENCE CAUTION:
Sequence=BAC98096.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK129286; BAC98096.1; ALT_INIT; mRNA.
EMBL; BC024683; AAH24683.3; -; mRNA.
EMBL; BC100408; AAI00409.1; -; mRNA.
CCDS; CCDS38480.1; -. [Q6ZPY2-1]
RefSeq; NP_839977.2; NM_178246.3. [Q6ZPY2-1]
UniGene; Mm.439830; -.
ProteinModelPortal; Q6ZPY2; -.
SMR; Q6ZPY2; -.
STRING; 10090.ENSMUSP00000001451; -.
iPTMnet; Q6ZPY2; -.
PhosphoSitePlus; Q6ZPY2; -.
EPD; Q6ZPY2; -.
PaxDb; Q6ZPY2; -.
PeptideAtlas; Q6ZPY2; -.
PRIDE; Q6ZPY2; -.
Ensembl; ENSMUST00000001451; ENSMUSP00000001451; ENSMUSG00000001415. [Q6ZPY2-1]
GeneID; 229512; -.
KEGG; mmu:229512; -.
UCSC; uc008pus.1; mouse. [Q6ZPY2-2]
UCSC; uc008put.1; mouse. [Q6ZPY2-1]
CTD; 23381; -.
MGI; MGI:2447364; Smg5.
eggNOG; ENOG410INQY; Eukaryota.
eggNOG; ENOG410XPF4; LUCA.
GeneTree; ENSGT00560000077120; -.
HOGENOM; HOG000261635; -.
HOVERGEN; HBG082268; -.
InParanoid; Q6ZPY2; -.
KO; K11125; -.
OMA; GMAQNQL; -.
OrthoDB; EOG091G0188; -.
PhylomeDB; Q6ZPY2; -.
TreeFam; TF327119; -.
Reactome; R-MMU-975957; Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC).
PRO; PR:Q6ZPY2; -.
Proteomes; UP000000589; Chromosome 3.
Bgee; ENSMUSG00000001415; Expressed in 279 organ(s), highest expression level in adipose tissue.
ExpressionAtlas; Q6ZPY2; baseline and differential.
Genevisible; Q6ZPY2; MM.
GO; GO:0005737; C:cytoplasm; ISS:HGNC.
GO; GO:0005634; C:nucleus; ISS:HGNC.
GO; GO:0005697; C:telomerase holoenzyme complex; IBA:GO_Central.
GO; GO:0042826; F:histone deacetylase binding; ISO:MGI.
GO; GO:0051721; F:protein phosphatase 2A binding; ISS:HGNC.
GO; GO:0004540; F:ribonuclease activity; IBA:GO_Central.
GO; GO:0043021; F:ribonucleoprotein complex binding; IBA:GO_Central.
GO; GO:0070034; F:telomerase RNA binding; ISO:MGI.
GO; GO:0042162; F:telomeric DNA binding; ISO:MGI.
GO; GO:0031625; F:ubiquitin protein ligase binding; ISO:MGI.
GO; GO:0006406; P:mRNA export from nucleus; IBA:GO_Central.
GO; GO:0000184; P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay; IBA:GO_Central.
GO; GO:0035303; P:regulation of dephosphorylation; ISS:HGNC.
GO; GO:0043487; P:regulation of RNA stability; IBA:GO_Central.
GO; GO:0032204; P:regulation of telomere maintenance; ISO:MGI.
GO; GO:0007004; P:telomere maintenance via telomerase; IBA:GO_Central.
InterPro; IPR018834; DNA/RNA-bd_Est1-type.
InterPro; IPR019458; EST1.
InterPro; IPR002716; PIN_dom.
InterPro; IPR011990; TPR-like_helical_dom_sf.
Pfam; PF10374; EST1; 1.
Pfam; PF10373; EST1_DNA_bind; 2.
Pfam; PF13638; PIN_4; 1.
SMART; SM00670; PINc; 1.
SUPFAM; SSF48452; SSF48452; 2.
1: Evidence at protein level;
Acetylation; Alternative splicing; Coiled coil; Complete proteome;
Cytoplasm; Nonsense-mediated mRNA decay; Nucleus; Phosphoprotein;
Polymorphism; Reference proteome.
INIT_MET 1 1 Removed. {ECO:0000250|UniProtKB:Q9UPR3}.
CHAIN 2 1017 Protein SMG5.
/FTId=PRO_0000076323.
DOMAIN 873 996 PINc.
COILED 798 842 {ECO:0000255}.
COMPBIAS 459 463 Poly-Arg.
MOD_RES 2 2 N-acetylserine.
{ECO:0000250|UniProtKB:Q9UPR3}.
MOD_RES 2 2 Phosphoserine.
{ECO:0000250|UniProtKB:Q9UPR3}.
MOD_RES 423 423 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
VAR_SEQ 620 702 ASEDGSESEGSESSNRSCRNERSLQEKLQALMAEGLLPAVK
VFLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPASAELQ
D -> GAWVHESPPSRRVTSPLGFCCHCGILVLCTYSFPAS
RTFAVLLLSTADCSSFTLFSPHIGGCTSFPHGIQLPEGSQK
LGIMFL (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016590.
VAR_SEQ 703 1017 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016591.
VARIANT 77 77 K -> R (in strain: B5/EGFP).
{ECO:0000269|PubMed:15489334}.
VARIANT 166 166 W -> L (in strain: Czech II).
{ECO:0000269|PubMed:15489334}.
VARIANT 499 499 D -> E (in strain: Czech II).
{ECO:0000269|PubMed:15489334}.
VARIANT 503 503 E -> G (in strain: Czech II).
{ECO:0000269|PubMed:15489334}.
SEQUENCE 1017 AA; 114071 MW; 9925688D6FAFAF5C CRC64;
MSQGPPPGES SEPEAKVLHT KRLYRAVVEA VHRLDLILCN KAAYQEVFKP ENVSLRNKLR
ELCVKLMFLH PVDYGRKAEE LLWRKVYYEV IQLIKTNKKH IHSRSTLECA YRTHLVAGIG
FYQHLLLYIQ SHYQLELQCC IDWTHVTDPL MGFKKPVSAS GKEMDWAQMA CHRCLVYLGD
LSRYQNELAG VDTELLAERF YYQALSVAPQ IGMPFNQLGT LAGSKYYNVE AMYCYLRCIQ
SEVSFEGAYG NLKRLYDKAA KMYHQLKKSE TRKLSPSKKR CKDIKRLLVN FMYLQSLLQP
KSSSVDSELT SLCQSVLEDF NLCLFYLPSS PNLGLTNEDE EECESGYAFL PDLLIFQMAI
ICLMGVHSLK RAGSKHYSAA IAFTLALFSH LINHVNIRLQ AELEEGENPV SAFQSDGTDE
PESKEALEKE EPEPEPPTVV PQADEGRKSR KHSRLSCLRR RRRHHPPKAG DDSDLSEGFE
SDSSHDSAQA SDGSDSGSDK SLEGRGTAFD AETDSEMNSQ ESRSDLEDME DEEGTRSPAQ
EPPQARSEVP DSLNGPLGPS EASIASNLQA MSTQMFQTKR CFRLAPTFSN LLLQPTTEPN
SVASHRPCVN GDMDKPLEPA SEDGSESEGS ESSNRSCRNE RSLQEKLQAL MAEGLLPAVK
VFLDWLRTNP DLIIVCAQSS QSLWNRLSVL LNLLPASAEL QDSGLALCSE VQGLLEGCEL
PDLPASLLLP EDMALRNLPP LRAAHRRFNF DADRPLLSAL EESVVRICCI RSFGHFVARL
QGSILQFNPE VGIFVSIAQS EQESLLQQAQ AQFRMAEEEA RRNRLMRDMA QLRLQLEVSQ
LEGSLQQPKA QSAMSPYLIP DTQALCYHLP LIRQLATSGR FIIIIPRTVI DGLDLLKKEQ
PGARDGIRYL EAEFKKGNRY IRCQKEVGKS FERHKLKRQD ADAWTLYKIL DSCRQLTLAQ
GAGEEDPSGM VTIITGLHLD SPSALSGPMQ AALQAAAHAS VDVKNVLDFY RQWKEIG


Related products :

Catalog number Product name Quantity
EIAAB38803 Est1b,EST1-like protein B,Kiaa1089,Mouse,Mus musculus,Protein SMG5,Smg5,SMG-5 homolog
EIAAB38802 EST1B,EST1-like protein B,Homo sapiens,hSMG-5,Human,KIAA1089,LPTS-interacting protein,LPTS-RP1,Protein SMG5,SMG5,SMG-5 homolog
EIAAB38805 C1orf16,EST1C,EST1-like protein C,Homo sapiens,hSMG-7,Human,KIAA0250,Protein SMG7,SMG7,SMG-7 homolog
EIAAB38804 Est1c,EST1-like protein C,Kiaa0250,Mouse,Mus musculus,Protein SMG7,Smg7,SMG-7 homolog
SMG5 SMG5 Gene Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)
SMG5_MOUSE ELISA Kit FOR Protein SMG5; organism: Mouse; gene name: Smg5 96T
SMG5_HUMAN ELISA Kit FOR Protein SMG5; organism: Human; gene name: SMG5 96T
CSB-EL021835HU Human Protein SMG5(SMG5) ELISA kit SpeciesHuman 96T
CSB-EL021835MO Mouse Protein SMG5(SMG5) ELISA kit SpeciesMouse 96T
G4188 Protein SMG5 (SMG5), Mouse, ELISA Kit 96T
CSB-EL021835MO Mouse Protein SMG5(SMG5) ELISA kit 96T
G4187 Protein SMG5 (SMG5), Human, ELISA Kit 96T
CSB-EL021835HU Human Protein SMG5(SMG5) ELISA kit 96T
EIAAB13339 Est1a,EST1-like protein A,Ever shorter telomeres 1A,Kiaa0732,Mouse,Mus musculus,Smg6,Smg-6 homolog,Telomerase subunit EST1A,Telomerase-binding protein EST1A
EIAAB13340 C17orf31,EST1A,EST1-like protein A,Ever shorter telomeres 1A,Homo sapiens,hSmg5_7a,Human,KIAA0732,SMG6,Smg-6 homolog,Telomerase subunit EST1A,Telomerase-binding protein EST1A
E1911p Human ELISA Kit FOR Protein SMG5 96T
H00023381-P01-25 SMG5 (Human) Recombinant Protein (P01) 25 ug
O10D3_HUMAN Mouse ELISA Kit FOR Protein SMG5 96T
E0499h Mouse ELISA Kit FOR Protein SMG5 96T
EIAAB05358 Btz,Cancer susceptibility candidate gene 3 protein homolog,Casc3,mBtz,Metastatic lymph node gene 51 protein homolog,MLN 51 homolog,Mln51,Mouse,Mus musculus,Protein barentsz,Protein CASC3
EIAAB40498 Homo sapiens,Human,Platelet Sec1 protein,Protein unc-18 homolog 3,Protein unc-18 homolog C,PSP,STXBP3,Syntaxin-binding protein 3,Unc18-3,Unc-18C
E3520h Human SMG5 Homolog, Nonsense Mediated mRNA Decay F 96T
EIAAB45359 hGMH1,Homo sapiens,HSD23,HSD-23,Human,PDLs22,Periodontal ligament-specific protein 22,Protein GMH1 homolog,Protein unc-50 homolog,UNC50,UNCL,Uncoordinated-like protein
EIAAB40499 Mammalian homolog of Unc-18c,Mouse,MUNC-18-3,Munc-18c,Mus musculus,Protein unc-18 homolog 3,Protein unc-18 homolog C,Stxbp3,Stxbp3a,Syntaxin-binding protein 3,Unc18-3,Unc18c,Unc-18C
201-20-5454 SMG5{Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)}rabbit.pAb 0.2ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur