Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein TBATA (Protein SPATIAL) (Stromal protein associated with thymii and lymph node) (Thymus, brain and testes-associated protein)

 TBATA_MOUSE             Reviewed;         393 AA.
Q7TSD4; B2ZA64; Q6XBG6; Q6XBG7; Q6XBG8; Q7TSD5; Q8BYU0; Q9EQE4;
Q9EQE5;
23-SEP-2008, integrated into UniProtKB/Swiss-Prot.
23-SEP-2008, sequence version 2.
12-SEP-2018, entry version 84.
RecName: Full=Protein TBATA;
AltName: Full=Protein SPATIAL;
AltName: Full=Stromal protein associated with thymii and lymph node {ECO:0000303|PubMed:11196687};
AltName: Full=Thymus, brain and testes-associated protein;
Name=Tbata; Synonyms=Spatial;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1] {ECO:0000305, ECO:0000312|EMBL:AAG37103.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6 AND 7), SUBCELLULAR LOCATION,
AND DEVELOPMENTAL STAGE.
STRAIN=C57BL/6J {ECO:0000312|EMBL:ACD01420.1};
TISSUE=Thymus {ECO:0000312|EMBL:ACD01420.1};
PubMed=11196687; DOI=10.1038/sj.gene.6363695;
Flomerfelt F.A., Kim M.G., Schwartz R.H.;
"Spatial, a gene expressed in thymic stromal cells, depends on three-
dimensional thymus organization for its expression.";
Genes Immun. 1:391-401(2000).
[2] {ECO:0000305, ECO:0000312|EMBL:AAP50908.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY, AND
DEVELOPMENTAL STAGE.
STRAIN=C57BL/6J {ECO:0000312|EMBL:AAP50908.1};
TISSUE=Testis {ECO:0000312|EMBL:AAP50908.1};
PubMed=12711538; DOI=10.1016/S1567-133X(03)00024-3;
Irla M., Puthier D., Le Goffic R., Victorero G., Freeman T.,
Naquet P., Samson M., Nguyen C.;
"Spatial, a new nuclear factor tightly regulated during mouse
spermatogenesis.";
Gene Expr. Patterns 3:135-138(2003).
[3] {ECO:0000305, ECO:0000312|EMBL:AAP41210.2}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), PARTIAL NUCLEOTIDE SEQUENCE
[MRNA] (ISOFORMS 4 AND 5), AND ALTERNATIVE SPLICING.
STRAIN=C57BL/6J {ECO:0000312|EMBL:AAP41210.2};
TISSUE=Fetal thymus {ECO:0000312|EMBL:AAP41212.1}, and
Thymus {ECO:0000312|EMBL:AAP41210.2};
PubMed=15236666; DOI=10.1186/1471-2164-5-41;
Irla M., Puthier D., Granjeaud S., Saade M., Victorero G.,
Mattei M.-G., Nguyen C.;
"Genomic organization and the tissue distribution of alternatively
spliced isoforms of the mouse Spatial gene.";
BMC Genomics 5:41-41(2004).
[4] {ECO:0000305, ECO:0000312|EMBL:ACD01420.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8).
STRAIN=C57BL/6J {ECO:0000312|EMBL:ACD01420.1};
TISSUE=Thymus {ECO:0000312|EMBL:ACD01420.1};
Flomerfelt F.A., Alleman M.K., League S.C., Gress R.E.;
Submitted (APR-2008) to the EMBL/GenBank/DDBJ databases.
[5] {ECO:0000305, ECO:0000312|EMBL:BAC29958.1}
PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
STRAIN=C57BL/6J {ECO:0000312|EMBL:BAC29958.1};
TISSUE=Thymus {ECO:0000312|EMBL:BAC29958.1};
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[6] {ECO:0000305}
FUNCTION, INTERACTION WITH KIF17, SUBCELLULAR LOCATION, AND
DEVELOPMENTAL STAGE.
PubMed=17196196; DOI=10.1016/j.yexcr.2006.11.011;
Saade M., Irla M., Govin J., Victorero G., Samson M., Nguyen C.;
"Dynamic distribution of Spatial during mouse spermatogenesis and its
interaction with the kinesin KIF17b.";
Exp. Cell Res. 313:614-626(2007).
[7]
DEVELOPMENTAL STAGE, AND INTERACTION WITH KIF17.
PubMed=17961552; DOI=10.1016/j.yexcr.2007.09.006;
Irla M., Saade M., Fernandez C., Chasson L., Victorero G., Dahmane N.,
Chazal G., Nguyen C.;
"Neuronal distribution of spatial in the developing cerebellum and
hippocampus and its somatodendritic association with the kinesin motor
KIF17.";
Exp. Cell Res. 313:4107-4119(2007).
[8]
FUNCTION, AND INTERACTION WITH UBA3.
PubMed=20937703; DOI=10.1084/jem.20092759;
Flomerfelt F.A., El Kassar N., Gurunathan C., Chua K.S., League S.C.,
Schmitz S., Gershon T.R., Kapoor V., Yan X.Y., Schwartz R.H.,
Gress R.E.;
"Tbata modulates thymic stromal cell proliferation and thymus
function.";
J. Exp. Med. 207:2521-2532(2010).
-!- FUNCTION: Isoform 1 and isoform 2 may play a role in spermatid
differentiation. Isoform 1 and isoform 2 regulate thymus function
by modulating stromal cell proliferation via interference with the
NEDD8 pathway. {ECO:0000269|PubMed:17196196,
ECO:0000269|PubMed:20937703}.
-!- SUBUNIT: Interacts with KIF17. Interacts with UBA3.
{ECO:0000269|PubMed:17196196, ECO:0000269|PubMed:17961552,
ECO:0000269|PubMed:20937703}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, cytosol
{ECO:0000269|PubMed:17196196}. Note=Located throughout the cytosol
of early round spermatids. By the end stages of round spermatid
development, concentrated at the side of the cell near the nascent
flagellum and in the manchette. In mature sperm, located in the
principle piece of the tail. {ECO:0000269|PubMed:17196196}.
-!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, cytosol
{ECO:0000269|PubMed:17196196}. Note=Located throughout the cytosol
of early round spermatids. By the end stages of round spermatid
development, concentrated at the side of the cell near the nascent
flagellum and in the manchette. In mature sperm, located in the
principle piece of the tail. {ECO:0000269|PubMed:17196196}.
-!- SUBCELLULAR LOCATION: Isoform 6: Nucleus
{ECO:0000269|PubMed:11196687}.
-!- SUBCELLULAR LOCATION: Isoform 7: Nucleus
{ECO:0000269|PubMed:11196687}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=1 {ECO:0000269|PubMed:12711538}; Synonyms=Epsilon
{ECO:0000269|PubMed:12711538};
IsoId=Q7TSD4-1; Sequence=Displayed;
Name=2 {ECO:0000269|PubMed:12711538}; Synonyms=Delta
{ECO:0000269|PubMed:12711538};
IsoId=Q7TSD4-2; Sequence=VSP_052937;
Name=3 {ECO:0000269|PubMed:15236666}; Synonyms=Beta
{ECO:0000269|PubMed:15236666};
IsoId=Q7TSD4-3; Sequence=VSP_052935, VSP_052937, VSP_052940,
VSP_052941, VSP_052942;
Name=4 {ECO:0000269|PubMed:15236666}; Synonyms=Alpha
{ECO:0000269|PubMed:15236666};
IsoId=Q7TSD4-4; Sequence=VSP_052935, VSP_052939, VSP_052941,
VSP_052942;
Name=5 {ECO:0000269|PubMed:15236666}; Synonyms=Gamma
{ECO:0000269|PubMed:15236666};
IsoId=Q7TSD4-5; Sequence=VSP_052937, VSP_052941, VSP_052942;
Name=6 {ECO:0000269|PubMed:11196687};
IsoId=Q7TSD4-6; Sequence=VSP_052935, VSP_052941, VSP_052942;
Name=7 {ECO:0000269|PubMed:11196687};
IsoId=Q7TSD4-7; Sequence=VSP_052935, VSP_052937, VSP_052941,
VSP_052942;
Name=8; Synonyms=Zeta;
IsoId=Q7TSD4-8; Sequence=VSP_052935, VSP_052936, VSP_052938;
-!- TISSUE SPECIFICITY: Expressed in the subcapsular region of the
thymus and lymph node (at protein level). Highly expressed in
thymic cortical stromal cells and testis. Lower levels found in
brain cortex, hippocampus, kidney, cerebellum, skeletal muscle,
epididymis and ovary. No expression detected in other lymphoid
organs including bone marrow and spleen. Isoform 1 and isoform 2
are expressed predominantly in testis. Isoform 3, isoform 4 and
isoform 5 are expressed predominantly in thymus although isoform 3
is also expressed in testis. In the CNS, highly expressed in
restricted areas, the cerebellum and hippocampus.
{ECO:0000269|PubMed:12711538}.
-!- DEVELOPMENTAL STAGE: In testis, isoform 1 and isoform 2 are
expressed only in the adult from postnatal week 7. Expression is
detected in pachytene spermatocytes, increases greatly in round
spermatids and is very strong in round/elongating and elongating
spermatids. Expression is reduced in condensed spermatids and
persists in spermatozoa. Isoform 3 is specifically expressed in
round spermatids and is greatly reduced in spermatids under
maturation (at protein level). Isoform 7 is detected in the embryo
from day 10 while isoform 7 is not detected until day 12. In
brain, predominantly expressed by granule cells during cerebellar
development. Isoform 1 and isoform 3 are differentially expressed
during cerebellar development. {ECO:0000269|PubMed:11196687,
ECO:0000269|PubMed:12711538, ECO:0000269|PubMed:17196196,
ECO:0000269|PubMed:17961552}.
-!- INDUCTION: Up-regulated in aged mice (4 months of age or older).
-!- SIMILARITY: Belongs to the TBATA family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAP41211.1; Type=Frameshift; Positions=22, 24, 45, 180, 212; Evidence={ECO:0000305};
Sequence=AAP50907.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=AAP50908.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF257502; AAG37103.1; -; mRNA.
EMBL; AF257503; AAG37104.1; -; mRNA.
EMBL; AF521591; AAP50907.1; ALT_INIT; mRNA.
EMBL; AF521592; AAP50908.1; ALT_INIT; mRNA.
EMBL; AY243457; AAP41210.2; -; mRNA.
EMBL; AY243458; AAP41211.1; ALT_FRAME; mRNA.
EMBL; AY243459; AAP41212.1; -; mRNA.
EMBL; EU622858; ACD01420.1; -; mRNA.
EMBL; AK038284; BAC29958.1; -; mRNA.
CCDS; CCDS23873.1; -. [Q7TSD4-1]
CCDS; CCDS23874.2; -. [Q7TSD4-5]
CCDS; CCDS48572.1; -. [Q7TSD4-2]
CCDS; CCDS48573.1; -. [Q7TSD4-6]
RefSeq; NP_001017407.1; NM_001017407.1. [Q7TSD4-7]
RefSeq; NP_001017409.1; NM_001017409.1.
RefSeq; NP_001017419.1; NM_001017419.2. [Q7TSD4-2]
RefSeq; NP_001017433.1; NM_001017433.2. [Q7TSD4-1]
RefSeq; NP_075551.3; NM_023064.3. [Q7TSD4-6]
UniGene; Mm.30227; -.
ProteinModelPortal; Q7TSD4; -.
BioGrid; 211165; 1.
STRING; 10090.ENSMUSP00000036422; -.
iPTMnet; Q7TSD4; -.
PhosphoSitePlus; Q7TSD4; -.
PaxDb; Q7TSD4; -.
PRIDE; Q7TSD4; -.
DNASU; 65971; -.
Ensembl; ENSMUST00000035894; ENSMUSP00000036422; ENSMUSG00000020096. [Q7TSD4-1]
Ensembl; ENSMUST00000079235; ENSMUSP00000078227; ENSMUSG00000020096. [Q7TSD4-6]
Ensembl; ENSMUST00000121297; ENSMUSP00000113253; ENSMUSG00000020096. [Q7TSD4-5]
Ensembl; ENSMUST00000122261; ENSMUSP00000113902; ENSMUSG00000020096. [Q7TSD4-2]
GeneID; 65971; -.
KEGG; mmu:65971; -.
UCSC; uc007ffm.2; mouse. [Q7TSD4-5]
UCSC; uc007ffn.2; mouse. [Q7TSD4-1]
UCSC; uc007ffo.2; mouse. [Q7TSD4-2]
UCSC; uc007ffq.1; mouse. [Q7TSD4-7]
UCSC; uc007ffr.2; mouse. [Q7TSD4-6]
CTD; 219793; -.
MGI; MGI:1923820; Tbata.
eggNOG; ENOG410IXP6; Eukaryota.
eggNOG; ENOG4111YVM; LUCA.
GeneTree; ENSGT00510000048896; -.
HOVERGEN; HBG106634; -.
InParanoid; Q7TSD4; -.
OMA; FWLLYAP; -.
OrthoDB; EOG091G0BB5; -.
PhylomeDB; Q7TSD4; -.
TreeFam; TF333401; -.
ChiTaRS; Tbata; mouse.
PRO; PR:Q7TSD4; -.
Proteomes; UP000000589; Chromosome 10.
Bgee; ENSMUSG00000020096; Expressed in 61 organ(s), highest expression level in thymus.
ExpressionAtlas; Q7TSD4; baseline and differential.
Genevisible; Q7TSD4; MM.
GO; GO:0005829; C:cytosol; IDA:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
GO; GO:0048515; P:spermatid differentiation; NAS:UniProtKB.
InterPro; IPR037394; TBATA-like.
PANTHER; PTHR33772; PTHR33772; 1.
Pfam; PF15256; SPATIAL; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm;
Developmental protein; Differentiation; Nucleus; Reference proteome;
Spermatogenesis.
CHAIN 1 393 Protein TBATA.
/FTId=PRO_0000351147.
VAR_SEQ 1 14 MTTEVNQLSEHPLV -> MFLGNVYKGSLAPRRDEVT (in
isoform 3, isoform 4, isoform 6, isoform
7 and isoform 8).
{ECO:0000303|PubMed:11196687,
ECO:0000303|PubMed:15236666,
ECO:0000303|Ref.4}.
/FTId=VSP_052935.
VAR_SEQ 98 166 VTGREDLEHSLPLTTSFQLLQAPGVQPMDLTPSADIAGKPV
CVVRDEFSLSALTQPTFLSRCLMGMPTI -> APSSSWGPA
HGSHSLCRYRWEACLRGQGRVLSVGLDSAHILIPLSDGDAH
HLCPHWGSTVQSEPPAFYF (in isoform 8).
{ECO:0000303|Ref.4}.
/FTId=VSP_052936.
VAR_SEQ 98 131 Missing (in isoform 2, isoform 3, isoform
5 and isoform 7).
{ECO:0000303|PubMed:11196687,
ECO:0000303|PubMed:12711538,
ECO:0000303|PubMed:15236666}.
/FTId=VSP_052937.
VAR_SEQ 167 393 Missing (in isoform 8).
{ECO:0000303|Ref.4}.
/FTId=VSP_052938.
VAR_SEQ 184 184 S -> SAEDTGRTKQHLPPPTPILPVLS (in isoform
4). {ECO:0000303|PubMed:15236666}.
/FTId=VSP_052939.
VAR_SEQ 185 185 D -> DLKTQGGQNNTYRPPPPSFLSSQT (in isoform
3). {ECO:0000303|PubMed:15236666}.
/FTId=VSP_052940.
VAR_SEQ 212 226 QKEEPPLREPPPREQ -> VGVAQRMEPRKKRPS (in
isoform 3, isoform 4, isoform 5, isoform
6 and isoform 7).
{ECO:0000303|PubMed:11196687,
ECO:0000303|PubMed:15236666}.
/FTId=VSP_052941.
VAR_SEQ 227 393 Missing (in isoform 3, isoform 4, isoform
5, isoform 6 and isoform 7).
{ECO:0000303|PubMed:11196687,
ECO:0000303|PubMed:15236666}.
/FTId=VSP_052942.
SEQUENCE 393 AA; 43842 MW; ED5BB0126B6A6947 CRC64;
MTTEVNQLSE HPLVSPKAEP QPETKPENLP RSHGDVGLQK ETVVPGIVDF ELIHEELKTT
KPQTSQPTPS AYRFGRLSHH SFFSRHHPQP QRVTHIQVTG REDLEHSLPL TTSFQLLQAP
GVQPMDLTPS ADIAGKPVCV VRDEFSLSAL TQPTFLSRCL MGMPTISVPI GDPQSNRNPQ
LSTSDTWRKK LKDLASRVTV FTKEIQPKPD EQKEEPPLRE PPPREQGAKY SAETGRLIPA
SSQALTRRNR QGQRVHPSSK DGGVQASILQ DQELLILELL CQILQTDSLR AIQFWLLYAP
SKEKDLALGL LQTAVAQLIP QPLSSIPAEK LWNHLQELQE PQETQEAAYS PSLKKTRSPP
LPKTDKPEYI GKAQVLLVHP SEDPEEKTTK AES


Related products :

Catalog number Product name Quantity
EIAAB39421 Mouse,Mus musculus,Protein SPATIAL,Spatial,Stromal protein associated with thymii and lymph node,Tbata
EIAAB39422 C10orf27,Homo sapiens,Human,Protein SPATIAL,SPATIAL,Stromal protein associated with thymii and lymph node homolog
EIAAB39423 Bos taurus,Bovine,Protein SPATIAL,SPATIAL,Stromal protein associated with thymii and lymph node homolog
LYS081A HUMAN LYMPH NODE TOTAL PROTEIN LYSATE, Product Type Cell Lysate, Specificity LYMPH NODE LYSATE, Target Species Human, Host N_A, Format Total Protein Lysate, Isotypes , Applications WB, Clone 0.5 mg
SCH-LYS081A HUMAN LYMPH NODE TOTAL PROTEIN LYSATE, Product Type Cell Lysate, Specificity LYMPH NODE LYSATE, Target Species Human, Host N_A, Format Total Protein Lysate, Isotypes , Applications WB, Clone 0.5 mg
SCH-LYS081B HUMAN LYMPH NODE TOTAL PROTEIN LYSATE, Product Type Cell Lysate, Specificity LYMPH NODE LYSATE, Target Species Human, Host N_A, Format Total Protein Lysate, Isotypes , Applications WB, Clone 1 mg
LYS081 HUMAN LYMPH NODE TOTAL PROTEIN LYSATE, Product Type Cell Lysate, Specificity LYMPH NODE LYSATE, Target Species Human, Host N_A, Format Total Protein Lysate, Isotypes , Applications WB, Clone 0.1 mg
SCH-LYS081 HUMAN LYMPH NODE TOTAL PROTEIN LYSATE, Product Type Cell Lysate, Specificity LYMPH NODE LYSATE, Target Species Human, Host N_A, Format Total Protein Lysate, Isotypes , Applications WB, Clone 0.1 mg
LYS081B HUMAN LYMPH NODE TOTAL PROTEIN LYSATE, Product Type Cell Lysate, Specificity LYMPH NODE LYSATE, Target Species Human, Host N_A, Format Total Protein Lysate, Isotypes , Applications WB, Clone 1 mg
EIAAB36554 Calgizzarin,Homo sapiens,Human,Metastatic lymph node gene 70 protein,MLN 70,MLN70,Protein S100-A11,Protein S100-C,S100 calcium-binding protein A11,S100A11,S100C
EIAAB05360 Btz,Cancer susceptibility candidate gene 3 protein,CASC3,Homo sapiens,Human,Metastatic lymph node gene 51 protein,MLN 51,MLN51,Protein barentsz,Protein CASC3
EIAAB40229 CAB1,Homo sapiens,Human,Metastatic lymph node gene 64 protein,MLN 64,MLN64,Protein CAB1,StARD3,STARD3,StAR-related lipid transfer protein 3,START domain-containing protein 3
EIAAB43769 CART1,Cysteine-rich domain associated with RING and Traf domains protein 1,Homo sapiens,Human,Metastatic lymph node gene 62 protein,MLN 62,MLN62,RING finger protein 83,RNF83,TNF receptor-associated fa
EIAAB05359 Bos taurus,Bovine,Btz,Cancer susceptibility candidate gene 3 protein,CASC3,Metastatic lymph node gene 51 protein homolog,MLN 51 homolog,MLN51,Protein barentsz,Protein CASC3
EIAAB05358 Btz,Cancer susceptibility candidate gene 3 protein homolog,Casc3,mBtz,Metastatic lymph node gene 51 protein homolog,MLN 51 homolog,Mln51,Mouse,Mus musculus,Protein barentsz,Protein CASC3
P1236161Lup Total Protein _ Lupus Lymph Node 1 mg
P1236161Lup Total Protein _ Lupus Lymph Node 1 mg
NB820-60602 Membrane Protein Lymph Node 0.1 mg
ABS10015 HUMAN LYMPH NODE TOTAL PROTEIN LYSATE 0.1 mg
P1236161Lcs Total Protein - Liver Cirrhosis: Lymph Node 1 mg
P1236161Lcs Total Protein _ Liver Cirrhosis Lymph Node 1 mg
P1236161Lcs Total Protein _ Liver Cirrhosis Lymph Node 1 mg
ABS10017 HUMAN LYMPH NODE TOTAL PROTEIN LYSATE 1 mg
ABS10016 HUMAN LYMPH NODE TOTAL PROTEIN LYSATE 0.5 mg
P3234161 Membrane Protein _ Human Adult Normal Tissue Lymph Node 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur