Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein TMEPAI (Prostate transmembrane protein androgen induced 1) (Solid tumor-associated 1 protein) (Transmembrane prostate androgen-induced protein)

 PMEPA_HUMAN             Reviewed;         287 AA.
Q969W9; Q5TDR6; Q8NER4; Q96B72; Q9UJD3;
05-MAR-2002, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
22-NOV-2017, entry version 130.
RecName: Full=Protein TMEPAI;
AltName: Full=Prostate transmembrane protein androgen induced 1;
AltName: Full=Solid tumor-associated 1 protein;
AltName: Full=Transmembrane prostate androgen-induced protein;
Name=PMEPA1; Synonyms=STAG1, TMEPAI;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
PubMed=10873380; DOI=10.1006/geno.2000.6214;
Xu L.L., Shanmugam N., Segawa T., Sesterhenn I.A., McLeod D.G.,
Moul J.W., Srivastava S.;
"A novel androgen-regulated gene, PMEPA1, located on chromosome 20q13
exhibits high level expression in prostate.";
Genomics 66:257-263(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=11568975; DOI=10.1002/mc.1063;
Rae F.K., Hooper J.D., Nicol D.L., Clements J.A.;
"Characterization of a novel gene, STAG1/PMEPA1, upregulated in renal
cell carcinoma and other solid tumors.";
Mol. Carcinog. 32:44-53(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
PubMed=12670906;
Brunschwig E.B., Wilson K., Mack D., Dawson D., Lawrence E.,
Willson J.K.V., Lu S., Nosrati A., Rerko R.M., Swinler S., Beard L.,
Lutterbaugh J.D., Willis J., Platzer P., Markowitz S.;
"PMEPA1, a transforming growth factor-beta-induced marker of terminal
colonocyte differentiation whose expression is maintained in primary
and metastatic colon cancer.";
Cancer Res. 63:1568-1575(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=11780052; DOI=10.1038/414865a;
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R.,
Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L.,
Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M.,
Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J.,
Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P.,
Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M.,
Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R.,
Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M.,
Ellington A.G., Frankland J.A., Fraser A., French L., Garner P.,
Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E.,
Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J.,
Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D.,
Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S.,
Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D.,
Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A.,
Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T.,
Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I.,
Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H.,
Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S.,
Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E.,
Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A.,
Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M.,
Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A.,
Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S.,
Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 20.";
Nature 414:865-871(2001).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-287 (ISOFORM 1).
TISSUE=Kidney;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
INTERACTION WITH NEDD4, AND MUTAGENESIS OF TYR-161 AND TYR-232.
PubMed=12907594;
Xu L.L., Shi Y., Petrovics G., Sun C., Makarem M., Zhang W.,
Sesterhenn I.A., McLeod D.G., Sun L., Moul J.W., Srivastava S.;
"PMEPA1, an androgen-regulated NEDD4-binding protein, exhibits cell
growth inhibitory function and decreased expression during prostate
cancer progression.";
Cancer Res. 63:4299-4304(2003).
[8]
FUNCTION, INTERACTION WITH AR, MOTIFS, MUTAGENESIS OF TYR-161 AND
TYR-232, AND INDUCTION BY ANDROGEN.
PubMed=18703514; DOI=10.1074/jbc.M710528200;
Li H., Xu L.L., Masuda K., Raymundo E., McLeod D.G., Dobi A.,
Srivastava S.;
"A feedback loop between the androgen receptor and a NEDD4-binding
protein, PMEPA1, in prostate cancer cells.";
J. Biol. Chem. 283:28988-28995(2008).
[9]
FUNCTION, INTERACTION WITH SMAD2 AND SMAD3, SUBCELLULAR LOCATION,
MOTIF, AND INDUCTION BY TGF-BETA.
PubMed=20129061; DOI=10.1016/j.molcel.2009.10.028;
Watanabe Y., Itoh S., Goto T., Ohnishi E., Inamitsu M., Itoh F.,
Satoh K., Wiercinska E., Yang W., Shi L., Tanaka A., Nakano N.,
Mommaas A.M., Shibuya H., Ten Dijke P., Kato M.;
"TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad
proteins from active participation in TGF-beta signaling.";
Mol. Cell 37:123-134(2010).
[10]
FUNCTION, INTERACTION WITH LDLRAD4, AND SUBCELLULAR LOCATION.
PubMed=24627487; DOI=10.1074/jbc.M114.558981;
Nakano N., Maeyama K., Sakata N., Itoh F., Akatsu R., Nakata M.,
Katsu Y., Ikeno S., Togawa Y., Vo Nguyen T.T., Watanabe Y., Kato M.,
Itoh S.;
"C18 ORF1, a novel negative regulator of transforming growth factor-
beta signaling.";
J. Biol. Chem. 289:12680-12692(2014).
-!- FUNCTION: Functions as a negative regulator of TGF-beta signaling
and thereby probably plays a role in cell proliferation,
differentiation, apoptosis, motility, extracellular matrix
production and immunosuppression. In the canonical TGF-beta
pathway, ZFYVE9/SARA recruits the intracellular signal transducer
and transcriptional modulators SMAD2 and SMAD3 to the TGF-beta
receptor. Phosphorylated by the receptor, SMAD2 and SMAD3 then
form a heteromeric complex with SMAD4 that translocates to the
nucleus to regulate transcription. Through interaction with SMAD2
and SMAD3, LDLRAD4 may compete with ZFYVE9 and SMAD4 and prevent
propagation of the intracellular signal (PubMed:20129061,
PubMed:24627487). Also involved in down-regulation of the androgen
receptor (AR), enhancing ubiquitination and proteasome-mediated
degradation of AR, probably by recruiting NEDD4 (PubMed:18703514).
{ECO:0000269|PubMed:18703514, ECO:0000269|PubMed:20129061,
ECO:0000269|PubMed:24627487}.
-!- SUBUNIT: Interacts with NEDD4 (via PPxY motifs). Interacts with
AR. Interacts with LDLRAD4. Interacts (via the SMAD interaction
motif) with SMAD2 and SMAD3. {ECO:0000269|PubMed:12907594,
ECO:0000269|PubMed:18703514, ECO:0000269|PubMed:20129061,
ECO:0000269|PubMed:24627487}.
-!- SUBCELLULAR LOCATION: Early endosome membrane; Single-pass
membrane protein. Golgi apparatus membrane; Single-pass membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=a;
IsoId=Q969W9-1; Sequence=Displayed;
Name=2; Synonyms=b;
IsoId=Q969W9-2; Sequence=VSP_006438;
Name=3; Synonyms=c;
IsoId=Q969W9-3; Sequence=VSP_044588;
-!- TISSUE SPECIFICITY: Highest expression in prostate. Also expressed
in ovary.
-!- INDUCTION: Up-regulated by androgen and TGF-beta (at protein
level). {ECO:0000269|PubMed:18703514,
ECO:0000269|PubMed:20129061}.
-!- DOMAIN: The PPxY motifs mediate interaction with NEDD4.
{ECO:0000269|PubMed:18703514}.
-!- DOMAIN: The SMAD interaction motif is required for interaction
with SMAD2 and SMAD3 and the negative regulation of TGF-beta
signaling. {ECO:0000269|PubMed:20129061}.
-!- SIMILARITY: Belongs to the PMEPA1 family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF224278; AAF86322.1; -; mRNA.
EMBL; AF305616; AAL16781.1; -; mRNA.
EMBL; AY128643; AAM89277.1; -; mRNA.
EMBL; AF305426; AAL09357.1; -; Genomic_DNA.
EMBL; AL035541; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL121913; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471077; EAW75505.1; -; Genomic_DNA.
EMBL; CH471077; EAW75508.1; -; Genomic_DNA.
EMBL; BC015918; AAH15918.2; -; mRNA.
CCDS; CCDS13462.1; -. [Q969W9-2]
CCDS; CCDS13463.1; -. [Q969W9-1]
CCDS; CCDS13464.1; -. [Q969W9-3]
RefSeq; NP_001242905.1; NM_001255976.1.
RefSeq; NP_064567.2; NM_020182.4. [Q969W9-1]
RefSeq; NP_954638.1; NM_199169.2. [Q969W9-2]
RefSeq; NP_954639.1; NM_199170.2. [Q969W9-3]
RefSeq; NP_954640.1; NM_199171.2. [Q969W9-3]
UniGene; Hs.517155; -.
ProteinModelPortal; Q969W9; -.
BioGrid; 121262; 9.
IntAct; Q969W9; 3.
MINT; MINT-4829946; -.
STRING; 9606.ENSP00000345826; -.
iPTMnet; Q969W9; -.
PhosphoSitePlus; Q969W9; -.
BioMuta; PMEPA1; -.
DMDM; 20140695; -.
PaxDb; Q969W9; -.
PeptideAtlas; Q969W9; -.
PRIDE; Q969W9; -.
Ensembl; ENST00000265626; ENSP00000265626; ENSG00000124225. [Q969W9-3]
Ensembl; ENST00000341744; ENSP00000345826; ENSG00000124225. [Q969W9-1]
Ensembl; ENST00000347215; ENSP00000344014; ENSG00000124225. [Q969W9-2]
Ensembl; ENST00000395814; ENSP00000379159; ENSG00000124225. [Q969W9-3]
Ensembl; ENST00000395816; ENSP00000379161; ENSG00000124225. [Q969W9-3]
GeneID; 56937; -.
KEGG; hsa:56937; -.
UCSC; uc002xyq.5; human. [Q969W9-1]
CTD; 56937; -.
DisGeNET; 56937; -.
EuPathDB; HostDB:ENSG00000124225.15; -.
GeneCards; PMEPA1; -.
HGNC; HGNC:14107; PMEPA1.
HPA; HPA072291; -.
MIM; 606564; gene.
neXtProt; NX_Q969W9; -.
OpenTargets; ENSG00000124225; -.
PharmGKB; PA162399822; -.
eggNOG; ENOG410IEW4; Eukaryota.
eggNOG; ENOG4111QDT; LUCA.
GeneTree; ENSGT00390000000724; -.
HOGENOM; HOG000276535; -.
HOVERGEN; HBG059833; -.
InParanoid; Q969W9; -.
OMA; QRDRFHR; -.
OrthoDB; EOG091G0HDA; -.
PhylomeDB; Q969W9; -.
TreeFam; TF331681; -.
Reactome; R-HSA-2173788; Downregulation of TGF-beta receptor signaling.
ChiTaRS; PMEPA1; human.
GeneWiki; TMEPAI; -.
GenomeRNAi; 56937; -.
PRO; PR:Q969W9; -.
Proteomes; UP000005640; Chromosome 20.
Bgee; ENSG00000124225; -.
CleanEx; HS_PMEPA1; -.
CleanEx; HS_STAG1; -.
ExpressionAtlas; Q969W9; baseline and differential.
Genevisible; Q969W9; HS.
GO; GO:0031901; C:early endosome membrane; IDA:UniProtKB.
GO; GO:0010008; C:endosome membrane; IDA:UniProtKB.
GO; GO:0000139; C:Golgi membrane; IDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0070412; F:R-SMAD binding; IPI:UniProtKB.
GO; GO:0050699; F:WW domain binding; IPI:UniProtKB.
GO; GO:0030521; P:androgen receptor signaling pathway; NAS:UniProtKB.
GO; GO:0060394; P:negative regulation of pathway-restricted SMAD protein phosphorylation; IDA:UniProtKB.
GO; GO:0010991; P:negative regulation of SMAD protein complex assembly; IDA:UniProtKB.
GO; GO:0030512; P:negative regulation of transforming growth factor beta receptor signaling pathway; IDA:UniProtKB.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Endosome; Golgi apparatus;
Membrane; Polymorphism; Reference proteome; Repeat;
Signal transduction inhibitor; Transmembrane; Transmembrane helix;
Ubl conjugation pathway.
CHAIN 1 287 Protein TMEPAI.
/FTId=PRO_0000185442.
TOPO_DOM 1 40 Lumenal. {ECO:0000255}.
TRANSMEM 41 63 Helical. {ECO:0000255}.
TOPO_DOM 64 287 Cytoplasmic. {ECO:0000255}.
MOTIF 158 161 PPxY motif 1.
MOTIF 186 189 SMAD interaction motif (SIM).
MOTIF 229 232 PPxY motif 2.
VAR_SEQ 1 50 Missing (in isoform 3).
{ECO:0000303|PubMed:12670906}.
/FTId=VSP_044588.
VAR_SEQ 1 37 MHRLMGVNSTAAAAAGQPNVSCTCNCKRSLFQSMEIT ->
MA (in isoform 2).
{ECO:0000303|PubMed:10873380}.
/FTId=VSP_006438.
VARIANT 128 128 E -> D (in dbSNP:rs41314918).
/FTId=VAR_062154.
MUTAGEN 161 161 Y->A: Impairs interaction with NEDD4.
Impairs polyubiquitination of AR; when
associated with A-232.
{ECO:0000269|PubMed:12907594,
ECO:0000269|PubMed:18703514}.
MUTAGEN 232 232 Y->A: Impairs interaction with NEDD4.
Impairs polyubiquitination of AR; when
associated with A-232.
{ECO:0000269|PubMed:12907594,
ECO:0000269|PubMed:18703514}.
SEQUENCE 287 AA; 31609 MW; 6103473561AE08DA CRC64;
MHRLMGVNST AAAAAGQPNV SCTCNCKRSL FQSMEITELE FVQIIIIVVV MMVMVVVITC
LLSHYKLSAR SFISRHSQGR RREDALSSEG CLWPSESTVS GNGIPEPQVY APPRPTDRLA
VPPFAQRERF HRFQPTYPYL QHEIDLPPTI SLSDGEEPPP YQGPCTLQLR DPEQQLELNR
ESVRAPPNRT IFDSDLMDSA RLGGPCPPSS NSGISATCYG SGGRMEGPPP TYSEVIGHYP
GSSFQHQQSS GPPSLLEGTR LHHTHIAPLE SAAIWSKEKD KQKGHPL


Related products :

Catalog number Product name Quantity
EIAAB31637 Homo sapiens,Human,PMEPA1,Solid tumor-associated 1 protein,STAG1,TMEPAI,Transmembrane prostate androgen-induced protein
EIAAB31636 Mouse,Mus musculus,N4wbp4,NEDD4 WW domain-binding protein 4,Pmepa1,Tmepai,Transmembrane prostate androgen-induced protein
201-20-4313 PMEPA1{prostate transmembrane protein, androgen induced 1}rabbit.pAb 0.2ml
PMEPA_MOUSE Mouse ELISA Kit FOR Transmembrane prostate androgen-induced protein 96T
PMFBP1 PMEPA1 Gene prostate transmembrane protein, androgen induced 1
EIAAB30443 Androgen-induced proliferation inhibitor,Androgen-induced prostate proliferative shutoff-associated protein AS3,Aprin,As3,Pds5b,Rat,Rattus norvegicus,Sister chromatid cohesion protein PDS5 homolog B
H8074 Transmembrane prostate androgen-induced protein (PMEPA1), Human, ELISA Kit 96T
CSB-EL018233HU Human Transmembrane prostate androgen-induced protein(PMEPA1) ELISA kit 96T
CSB-EL018233MO Mouse Transmembrane prostate androgen-induced protein(PMEPA1) ELISA kit 96T
H8075 Transmembrane prostate androgen-induced protein (PMEPA1), Mouse, ELISA Kit 96T
EIAAB30441 Androgen-induced proliferation inhibitor,Androgen-induced prostate proliferative shutoff-associated protein AS3,Aprin,As3,Kiaa0979,Mouse,Mus musculus,Pds5b,Sister chromatid cohesion protein PDS5 homol
EIAAB30444 Androgen-induced proliferation inhibitor,Androgen-induced prostate proliferative shutoff-associated protein AS3,APRIN,AS3,Homo sapiens,Human,KIAA0979,PDS5B,Sister chromatid cohesion protein PDS5 homol
CSB-EL018233MO Mouse Transmembrane prostate androgen-induced protein(PMEPA1) ELISA kit SpeciesMouse 96T
CSB-EL018233HU Human Transmembrane prostate androgen-induced protein(PMEPA1) ELISA kit SpeciesHuman 96T
PMEPA_MOUSE ELISA Kit FOR Transmembrane prostate androgen-induced protein; organism: Mouse; gene name: Pmepa1 96T
TMEPA1-101AP Transmembrane prostate androgen-induced protein A1 Polyclonal anbtibody Host: Rabbit Affinity purifed 200ul
TMEPA1-101AP Transmembrane prostate androgen-induced protein A1 WB control: PC-TMEPA1 Host: Rabbit Affinity purifed 100-150ul
TMEPA1-101AP Transmembrane prostate androgen-induced protein A1 Antigenic peptide: P-TMEPA1 Host: Rabbit Affinity purifed 100ul
EIAAB29917 Castration-induced prostatic apoptosis-related protein 1,Cipar1,CIPAR-1,Parm1,PARM-1,Prostate androgen-regulated mucin-like protein 1 homolog,Prostatic androgen-repressed message 1 protein,Rat,Rattus
CSB-EL018233MO Mouse prostate transmembrane protein, androgen induced 1 (PMEPA1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL018233HU Human prostate transmembrane protein, androgen induced 1 (PMEPA1) ELISA kit, Species Human, Sample Type serum, plasma 96T
EIAAB40271 Homo sapiens,Human,Metalloreductase STEAP4,Six-transmembrane epithelial antigen of prostate 4,SixTransMembrane protein of prostate 2,STAMP2,STEAP4,TNFAIP9,Tumor necrosis factor, alpha-induced protein
TMEPA1-101AP Transmembrane prostate androgen-induced protein A1 Biotin Conjugates: TMEPA1-Biotin Host: Rabbit Affinity purifed 200ul
TMEPA1-101AP Transmembrane prostate androgen-induced protein A1 FITC-conjugates: TMEPA1-FITC Host: Rabbit Affinity purifed 200ul
EIAAB40978 Rat,Rattus norvegicus,Tmem120a,Tmpit,Transmembrane protein 120A,Transmembrane protein induced by tumor necrosis factor alpha


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur