Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein ZNF365 (DISC1-binding zinc-finger protein) (Protein su48)

 ZN365_HUMAN             Reviewed;         407 AA.
Q70YC5; A8K0F0; O94930; Q05D75; Q5HYE6; Q68SG8; Q6NSK2; Q6P9D4;
Q70YC6; Q70YC7;
20-DEC-2005, integrated into UniProtKB/Swiss-Prot.
11-JAN-2011, sequence version 3.
18-JUL-2018, entry version 114.
RecName: Full=Protein ZNF365;
AltName: Full=DISC1-binding zinc-finger protein {ECO:0000303|PubMed:17389905};
AltName: Full=Protein su48;
Name=ZNF365; Synonyms=DBZ {ECO:0000303|PubMed:17389905}, KIAA0844;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), VARIANT SER-337, AND
TISSUE SPECIFICITY.
TISSUE=Kidney;
PubMed=12740763; DOI=10.1086/375628;
Gianfrancesco F., Esposito T., Ombra M.N., Forabosco P.,
Maninchedda G., Fattorini M., Casula S., Vaccargiu S., Casu G.,
Cardia F., Deiana I., Melis P., Falchi M., Pirastu M.;
"Identification of a novel gene and a common variant associated with
uric acid nephrolithiasis in a Sardinian genetic isolate.";
Am. J. Hum. Genet. 72:1479-1491(2003).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
SER-337.
TISSUE=Brain;
PubMed=10048485; DOI=10.1093/dnares/5.6.355;
Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M.,
Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XII.
The complete sequences of 100 new cDNA clones from brain which code
for large proteins in vitro.";
DNA Res. 5:355-364(1998).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
SER-337.
TISSUE=Brain, and Cerebellum;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5), AND VARIANT
SER-337.
TISSUE=Cervix;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164054; DOI=10.1038/nature02462;
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J.,
Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D.,
Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L.,
Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S.,
Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L.,
Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J.,
Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M.,
Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S.,
Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M.,
Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A.,
Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T.,
Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I.,
Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T.,
Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W.,
Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H.,
Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L.,
Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K.,
Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T.,
Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 10.";
Nature 429:375-381(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), AND NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 1-394 (ISOFORM 1).
TISSUE=Brain, and Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-247.
Anitha A., Nakamura K., Mori N.;
Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases.
[8]
ALTERNATIVE SPLICING.
PubMed=15363853; DOI=10.1016/j.gene.2004.06.030;
Gianfrancesco F., Esposito T., Casu G., Maninchedda G., Roberto R.,
Parastu M.;
"Emergence of talanin protein associated with human uric acid
nephrolithiasis in the hominidae lineage.";
Gene 339:131-138(2004).
[9]
INTERACTION WITH NDE1 AND NDEL1.
PubMed=16682949; DOI=10.1038/sj.onc.1209637;
Hirohashi Y., Wang Q., Liu Q., Li B., Du X., Zhang H., Furuuchi K.,
Masuda K., Sato N., Greene M.I.;
"Centrosomal proteins Nde1 and Su48 form a complex regulated by
phosphorylation.";
Oncogene 25:6048-6055(2006).
[10]
HOMODIMERIZATION, AND SUBCELLULAR LOCATION.
PubMed=16617106; DOI=10.1073/pnas.0601682103;
Wang Q., Du X., Meinkoth J., Hirohashi Y., Zhang H., Liu Q.,
Richter M., Greene M.I.;
"Characterization of Su48, a centrosome protein essential for cell
division.";
Proc. Natl. Acad. Sci. U.S.A. 103:6512-6517(2006).
[11]
FUNCTION, INTERACTION WITH DISC1, AND TISSUE SPECIFICITY.
PubMed=17389905; DOI=10.1038/sj.mp.4001945;
Hattori T., Baba K., Matsuzaki S., Honda A., Miyoshi K., Inoue K.,
Taniguchi M., Hashimoto H., Shintani N., Baba A., Shimizu S.,
Yukioka F., Kumamoto N., Yamaguchi A., Tohyama M., Katayama T.;
"A novel DISC1-interacting partner DISC1-binding zinc-finger protein:
implication in the modulation of DISC1-dependent neurite outgrowth.";
Mol. Psychiatry 12:398-407(2007).
[12]
FUNCTION.
PubMed=23776040; DOI=10.1158/2159-8290.CD-12-0536;
Zhang Y., Shin S.J., Liu D., Ivanova E., Foerster F., Ying H.,
Zheng H., Xiao Y., Chen Z., Protopopov A., Depinho R.A., Paik J.H.;
"ZNF365 promotes stability of fragile sites and telomeres.";
Cancer Discov. 3:798-811(2013).
[13]
FUNCTION, INTERACTION WITH PARP1, AND INDUCTION.
PubMed=23966166; DOI=10.4161/cc.25882;
Zhang Y., Park E., Kim C.S., Paik J.H.;
"ZNF365 promotes stalled replication forks recovery to maintain genome
stability.";
Cell Cycle 12:2817-2828(2013).
-!- FUNCTION: Involved in the regulation of neurogenesis. Negatively
regulates neurite outgrowth (PubMed:17389905). Involved in the
morphogenesis of basket cells in the somatosensory cortex during
embryogenesis. Involved in the positive regulation of
oligodendrocyte differentiation during postnatal growth. Involved
in dendritic arborization, morphogenesis of spine density
dendrite, and establishment of postsynaptic dendrite density in
cortical pyramidal neurons (By similarity). Involved in homologous
recombination (HR) repair pathway. Required for proper resolution
of DNA double-strand breaks (DSBs) by HR. Is required for recovery
of stalled replication forks, and directly contributes to genomic
stability. Interacts with PARP1 and mediates MRE11-dependent DNA
end resection during replication fork recovery (PubMed:23966166).
Contributes to genomic stability by preventing telomere
dysfunction (PubMed:23776040). {ECO:0000250|UniProtKB:Q8BG89,
ECO:0000269|PubMed:17389905, ECO:0000269|PubMed:23776040,
ECO:0000269|PubMed:23966166}.
-!- SUBUNIT: Homodimer. Interacts with NDE1 and NDEL1. Does not
interact with TUBG1. Interacts with DISC1 (PubMed:17389905).
Interacts with PARP1 (PubMed:23966166).
{ECO:0000269|PubMed:16682949, ECO:0000269|PubMed:17389905,
ECO:0000269|PubMed:23966166}.
-!- INTERACTION:
Q9NXR1:NDE1; NbExp=3; IntAct=EBI-941182, EBI-941227;
-!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton, microtubule
organizing center, centrosome {ECO:0000269|PubMed:16617106}.
Note=localizes to the centrosome at all stages of the cell cycle.
{ECO:0000269|PubMed:16617106}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Comment=Additional isoforms seem to exist.;
Name=1; Synonyms=ZNF365A;
IsoId=Q70YC5-1; Sequence=Displayed;
Name=2; Synonyms=ZNF365B;
IsoId=Q70YC5-2; Sequence=VSP_016599, VSP_016600;
Name=3; Synonyms=ZNF365C;
IsoId=Q70YC5-3; Sequence=VSP_016598;
Name=5;
IsoId=Q70YC5-4; Sequence=VSP_016597;
Note=No experimental confirmation available.;
Name=6;
IsoId=Q70YC5-5; Sequence=VSP_016596;
Note=No experimental confirmation available.;
Name=4; Synonyms=Talanin, ZNF365D;
IsoId=Q70YC4-1; Sequence=External;
-!- TISSUE SPECIFICITY: Isoform 1 is expressed in brain. Isoform 2 is
expressed in placenta and at low level in lung and liver. Isoform
3 is expressed in kidney and pancreas. Isoform 1 is expressed
exclusively in brain (PubMed:17389905).
{ECO:0000269|PubMed:12740763, ECO:0000269|PubMed:17389905}.
-!- INDUCTION: Induced by gamma irradiation and zeocin.
{ECO:0000269|PubMed:23966166}.
-!- MISCELLANEOUS: Cells silencing ZNF365 display delayed mitotic
progression and exit, due to increased replication stress, and
ultimately leading to cytokinesis failure, re-duplication of
centrosomes and increased aneuploidy.
{ECO:0000269|PubMed:23966166}.
-!- SEQUENCE CAUTION:
Sequence=AAH17841.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};
Sequence=BAA74867.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ505147; CAD43726.1; -; mRNA.
EMBL; AJ505148; CAD43727.1; -; mRNA.
EMBL; AJ505149; CAD43728.1; -; mRNA.
EMBL; AB020651; BAA74867.2; ALT_INIT; mRNA.
EMBL; AK289515; BAF82204.1; -; mRNA.
EMBL; AK289808; BAF82497.1; -; mRNA.
EMBL; BX647904; CAI46100.1; -; mRNA.
EMBL; AC024597; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC024598; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC017841; AAH17841.1; ALT_SEQ; mRNA.
EMBL; BC035049; AAH35049.1; -; mRNA.
EMBL; BC060817; AAH60817.1; -; mRNA.
EMBL; AY547355; AAT27443.1; -; Genomic_DNA.
CCDS; CCDS31209.1; -. [Q70YC5-1]
CCDS; CCDS41531.1; -. [Q70YC5-2]
CCDS; CCDS7264.1; -. [Q70YC5-3]
RefSeq; NP_055766.2; NM_014951.2. [Q70YC5-1]
RefSeq; NP_955522.1; NM_199450.2. [Q70YC5-2]
RefSeq; NP_955523.1; NM_199451.2. [Q70YC5-3]
UniGene; Hs.22653; -.
ProteinModelPortal; Q70YC5; -.
SMR; Q70YC5; -.
BioGrid; 116557; 2.
CORUM; Q70YC5; -.
DIP; DIP-35261N; -.
IntAct; Q70YC5; 3.
iPTMnet; Q70YC5; -.
PhosphoSitePlus; Q70YC5; -.
BioMuta; CACNA1A; -.
DMDM; 317373495; -.
MaxQB; Q70YC5; -.
PeptideAtlas; Q70YC5; -.
PRIDE; Q70YC5; -.
ProteomicsDB; 68572; -.
ProteomicsDB; 68573; -. [Q70YC5-2]
ProteomicsDB; 68574; -. [Q70YC5-3]
ProteomicsDB; 68575; -. [Q70YC5-4]
ProteomicsDB; 68576; -. [Q70YC5-5]
DNASU; 22891; -.
Ensembl; ENST00000395254; ENSP00000378674; ENSG00000138311. [Q70YC5-1]
Ensembl; ENST00000395255; ENSP00000378675; ENSG00000138311. [Q70YC5-2]
Ensembl; ENST00000410046; ENSP00000387091; ENSG00000138311. [Q70YC5-3]
GeneID; 22891; -.
KEGG; hsa:22891; -.
UCSC; uc001jlz.5; human. [Q70YC5-1]
CTD; 22891; -.
DisGeNET; 22891; -.
EuPathDB; HostDB:ENSG00000138311.15; -.
GeneCards; ZNF365; -.
HGNC; HGNC:18194; ZNF365.
HPA; HPA052446; -.
MalaCards; ZNF365; -.
MIM; 607818; gene.
neXtProt; NX_Q70YC5; -.
OpenTargets; ENSG00000138311; -.
PharmGKB; PA134873576; -.
GeneTree; ENSGT00530000063713; -.
HOVERGEN; HBG094181; -.
InParanoid; Q70YC5; -.
KO; K16737; -.
OMA; THFHPKG; -.
OrthoDB; EOG091G0BHK; -.
PhylomeDB; Q70YC5; -.
TreeFam; TF329439; -.
ChiTaRS; ZNF365; human.
GenomeRNAi; 22891; -.
Proteomes; UP000005640; Chromosome 10.
Bgee; ENSG00000138311; -.
CleanEx; HS_ZNF365; -.
ExpressionAtlas; Q70YC5; baseline and differential.
Genevisible; Q70YC5; HS.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005815; C:microtubule organizing center; IDA:HPA.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0021687; P:cerebellar molecular layer morphogenesis; ISS:UniProtKB.
GO; GO:0140059; P:dendrite arborization; ISS:UniProtKB.
GO; GO:0060997; P:dendritic spine morphogenesis; ISS:UniProtKB.
GO; GO:0010977; P:negative regulation of neuron projection development; IDA:UniProtKB.
GO; GO:0048714; P:positive regulation of oligodendrocyte differentiation; ISS:UniProtKB.
GO; GO:0110026; P:regulation of DNA strand resection involved in replication fork processing; IMP:UniProtKB.
GO; GO:0010569; P:regulation of double-strand break repair via homologous recombination; IMP:UniProtKB.
GO; GO:0000723; P:telomere maintenance; IMP:UniProtKB.
1: Evidence at protein level;
Alternative splicing; Coiled coil; Complete proteome; Cytoplasm;
Cytoskeleton; Metal-binding; Neurogenesis; Phosphoprotein;
Polymorphism; Reference proteome; Zinc; Zinc-finger.
CHAIN 1 407 Protein ZNF365.
/FTId=PRO_0000076374.
ZN_FING 26 51 C2H2-type; degenerate.
{ECO:0000255|PROSITE-ProRule:PRU00042}.
COILED 169 297 {ECO:0000255}.
MOD_RES 16 16 Phosphoserine.
{ECO:0000250|UniProtKB:Q8BG89}.
MOD_RES 138 138 Phosphoserine.
{ECO:0000250|UniProtKB:Q8BG89}.
MOD_RES 175 175 Phosphothreonine.
{ECO:0000250|UniProtKB:Q8BG89}.
MOD_RES 369 369 Phosphoserine.
{ECO:0000250|UniProtKB:Q5PQS2}.
VAR_SEQ 1 356 Missing (in isoform 6).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016596.
VAR_SEQ 1 1 M -> MTMRPPQSCEPTFRVM (in isoform 5).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_016597.
VAR_SEQ 309 407 LTDISSNRKPKCLSRGHPHSVCNHPDLKAHFHPKGRNHLKK
AKDDRASMQPAKAIHEQAESSRDLCRPPKKGELLGFGRKGN
IRPKMAKKKPTAIVNII -> SWKGAGEARLVCQNDLELEI
FGHINHHLSGLKDSHCLVFLQAPPVPWIILASFLWILGNPW
TSSTATAGFSQIWVLFPFCGGTFHHNEKDVLGLQDFERESV
STSQSRNISLLTLGQLQNCVIGKLTIIDLLTEHLLGVRHGV
ICFPWGLPSSS (in isoform 3).
{ECO:0000303|PubMed:12740763}.
/FTId=VSP_016598.
VAR_SEQ 309 333 LTDISSNRKPKCLSRGHPHSVCNHP -> SWKGAGEARLVC
QNDLELEESAIVE (in isoform 2).
{ECO:0000303|PubMed:12740763}.
/FTId=VSP_016599.
VAR_SEQ 334 407 Missing (in isoform 2).
{ECO:0000303|PubMed:12740763}.
/FTId=VSP_016600.
VARIANT 337 337 A -> S (in dbSNP:rs3758490).
{ECO:0000269|PubMed:10048485,
ECO:0000269|PubMed:12740763,
ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:17974005}.
/FTId=VAR_024325.
CONFLICT 55 55 E -> Q (in Ref. 7; AAT27443).
{ECO:0000305}.
SEQUENCE 407 AA; 46542 MW; CC3C25AF6A753E64 CRC64;
MQQKAFEESR YPWQESFENV AVCLPLRCPR CGDHTRFRSL SSLRAHLEFS HSYEERTLLT
KCSLFPSLKD TDLVTSSELL KPGKLQSSGN VVKQKPSYVN LYSISHEHSK DRKPFEVVAE
RPVSYVQTYT AMDLHADSLD GTRSGPGLPT SDTKASFEAH VREKFNRMVE AVDRTIEKRI
DKLTKELAQK TAELLEVRAA FVQLTQKKQE VQRRERALNR QVDVAVEMIA VLRQRLTESE
EELLRKEEEV VTFNHFLEAA AEKEVQGKAR LQDFIENLLQ RVELAEKQLE YYQSQQASGF
VRDLSGHVLT DISSNRKPKC LSRGHPHSVC NHPDLKAHFH PKGRNHLKKA KDDRASMQPA
KAIHEQAESS RDLCRPPKKG ELLGFGRKGN IRPKMAKKKP TAIVNII


Related products :

Catalog number Product name Quantity
EIAAB47416 Homo sapiens,Human,KIAA0844,Protein su48,Protein ZNF365,ZNF365
EIAAB47417 Kiaa0844,Mouse,Mus musculus,Protein ZNF365,Su48,Zfp365,Znf365
EIAAB46813 LP-1,Mouse,Mus musculus,Polyomavirus late initiator promoter-binding protein,Zbtb17,Zfp100,Zfp-100,Zinc finger and BTB domain-containing protein 17,Zinc finger protein 100,Zinc finger protein 151,Zinc
EIAAB47352 CT-ZFP48,EBV-induced zinc finger protein,Epstein-Barr virus-induced zinc finger protein,Homo sapiens,Human,Zinc finger protein 271,Zinc finger protein dp,Zinc finger protein HZF7,Zinc finger protein Z
EIAAB47194 Homo sapiens,Human,Zf47,ZFP47,Zfp-47,Zinc finger and SCAN domain-containing protein 13,Zinc finger protein 306,Zinc finger protein 309,Zinc finger protein 47 homolog,Zinc finger protein with KRAB and
EIAAB47360 GC-box-binding zinc finger protein 1,GZP1,Homo sapiens,Human,Transcription factor ZBP-99,ZBP99,Zinc finger DNA-binding protein 99,Zinc finger protein 281,ZNF281
EIAAB47340 BMZF5,BMZF-5,Bone marrow zinc finger 5,HD-ZNF1,Hematopoietic cell-derived zinc finger protein 1,Homo sapiens,Human,Zinc finger protein 254,Zinc finger protein 539,Zinc finger protein 91-like,ZNF254,ZN
EIAAB47314 BMZF2,BMZF-2,Bone marrow zinc finger 2,Homo sapiens,Human,KOX22,Zinc finger protein 224,Zinc finger protein 233,Zinc finger protein 255,Zinc finger protein 27,Zinc finger protein KOX22,ZNF224,ZNF233,Z
EIAAB46826 FANCC-interacting protein,Fanconi anemia zinc finger protein,FAZF,Homo sapiens,Human,Testis zinc finger protein,TZFP,ZBTB32,Zinc finger and BTB domain-containing protein 32,Zinc finger protein 538,ZNF
EIAAB35961 FINB,Finger protein in nuclear bodies,Homo sapiens,Human,Raf-responsive zinc finger protein LZ321,Ras-responsive element-binding protein 1,RREB1,RREB-1,Zep-1,Zinc finger motif enhancer-binding protein
ZNF365 ZNF365 Gene zinc finger protein 365
EIAAB47193 Mouse,Mus musculus,SCAN-KRAB-zinc finger protein,Skz1,Zf47,Zfp306,Zfp307,Zfp47,Zfp-47,Zinc finger protein 306,Zinc finger protein 307,Zinc finger protein 47 homolog,Zinc finger protein with KRAB and S
EIAAB47355 Homo sapiens,Human,Neurotrophin receptor-interacting factor homolog,SP2114,Zf2,Zinc finger protein 274,Zinc finger protein HFB101,Zinc finger protein with KRAB and SCAN domains 19,Zinc finger protein
EIAAB47395 C2H2-like zinc finger protein rearranged in thyroid adenomas,Homo sapiens,Human,RITA,Zinc finger protein 331,Zinc finger protein 361,Zinc finger protein 463,ZNF331,ZNF361,ZNF463
EIAAB47878 HDSG1,Heart development-specific gene 1 protein,Homo sapiens,Human,KOX11,Zinc finger protein 18,Zinc finger protein 535,Zinc finger protein KOX11,Zinc finger protein with KRAB and SCAN domains 6,ZKSCA
EIAAB14743 Fez family zinc finger protein 2,FEZF2,FEZL,FKSG36,Forebrain embryonic zinc finger-like protein 2,Homo sapiens,Human,Zinc finger protein 312,Zinc finger protein Fez-like,ZNF312
EIAAB47275 Homo sapiens,Human,Zinc finger protein 167,Zinc finger protein 448,Zinc finger protein 64,Zinc finger protein with KRAB and SCAN domains 7,ZKSCAN7,ZNF167,ZNF448,ZNF64
EIAAB47892 Homo sapiens,Human,KOX17,Retinoic acid suppression protein A,RSG-A,Zinc finger and SCAN domain-containing protein 3,Zinc finger protein 191,Zinc finger protein 24,Zinc finger protein KOX17,ZNF191,ZNF2
EIAAB46812 Homo sapiens,Human,MIZ1,Miz-1,Myc-interacting zinc finger protein 1,ZBTB17,Zinc finger and BTB domain-containing protein 17,Zinc finger protein 151,Zinc finger protein 60,ZNF151,ZNF60
18-003-42388 Zinc finger protein 24 - Zinc finger protein 191; Zinc finger protein KOX17; Retinoic acid suppression protein A; RSG-A; Zinc finger and SCAN domain-containing protein 3 Polyclonal 0.05 mg Aff Pur
EIAAB47067 Alpha-fetoprotein enhancer-binding protein,AT motif-binding factor,ATBF1,AT-binding transcription factor 1,Homo sapiens,Human,ZFH-3,ZFHX3,Zinc finger homeobox protein 3,Zinc finger homeodomain protein
EIAAB47066 Alpha-fetoprotein enhancer-binding protein,AT motif-binding factor,Atbf1,AT-binding transcription factor 1,Mouse,Mus musculus,ZFH-3,Zfhx3,Zinc finger homeobox protein 3,Zinc finger homeodomain protein
EIAAB47325 Homo sapiens,Human,ZFP93,Zfp-93,Zinc finger protein 235,Zinc finger protein 270,Zinc finger protein 93 homolog,Zinc finger protein HZF6,ZNF235,ZNF270
EIAAB14741 Fez,Fez family zinc finger protein 2,Fezf2,Fezl,Forebrain embryonic zinc finger-like protein 2,Mouse,Mus musculus,Zfp312,Zinc finger protein 312,Zinc finger protein Fez-like
EIAAB47384 Homo sapiens,Human,Zinc finger protein 322,Zinc finger protein 322A,Zinc finger protein 388,Zinc finger protein 489,ZNF322,ZNF322A,ZNF388,ZNF489


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur