Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein lap4 (Protein scribble) (Protein smell-impaired)

 LAP4_DROME              Reviewed;        1851 AA.
Q7KRY7; A0A0B4K7L2; A4V3G5; Q59DT7; Q59DT8; Q6AWK8; Q7K9X1; Q7KA36;
Q86QS7; Q86QS8; Q86QS9; Q86QT0; Q8IMR8; Q8IMR9; Q8T003; Q95SV4;
Q9VBE4;
31-AUG-2004, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
20-DEC-2017, entry version 147.
RecName: Full=Protein lap4;
AltName: Full=Protein scribble;
AltName: Full=Protein smell-impaired;
Name=scrib {ECO:0000312|EMBL:AAF56598.2};
Synonyms=smi {ECO:0000303|PubMed:12930751},
vart {ECO:0000312|EMBL:CAB71137.1}; ORFNames=CG5462;
Drosophila melanogaster (Fruit fly).
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
Ephydroidea; Drosophilidae; Drosophila; Sophophora.
NCBI_TaxID=7227;
[1] {ECO:0000305, ECO:0000312|EMBL:AAF26357.2}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), FUNCTION, SUBCELLULAR
LOCATION, DEVELOPMENTAL STAGE, AND DISRUPTION PHENOTYPE.
TISSUE=Embryo {ECO:0000269|PubMed:10688207};
PubMed=10688207; DOI=10.1038/35001108;
Bilder D., Perrimon N.;
"Localization of apical epithelial determinants by the basolateral PDZ
protein Scribble.";
Nature 403:676-680(2000).
[2] {ECO:0000305, ECO:0000312|EMBL:CAB70601.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND C), FUNCTION, TISSUE
SPECIFICITY, AND DEVELOPMENTAL STAGE.
PubMed=11578873; DOI=10.1016/S0925-4773(01)00482-8;
Li M., Marhold J., Gatos A., Torok I., Mechler B.M.;
"Differential expression of two scribble isoforms during Drosophila
embryogenesis.";
Mech. Dev. 108:185-190(2001).
[3] {ECO:0000305, ECO:0000312|EMBL:AAO32792.1}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A; C; D; E; G AND J), NUCLEOTIDE
SEQUENCE [MRNA] OF 639-1851 (ISOFORM F), FUNCTION, TISSUE SPECIFICITY,
AND DEVELOPMENTAL STAGE.
TISSUE=Head {ECO:0000269|PubMed:12930751};
PubMed=12930751;
Ganguly I., Mackay T.F.C., Anholt R.R.H.;
"Scribble is essential for olfactory behavior in Drosophila
melanogaster.";
Genetics 164:1447-1457(2003).
[4] {ECO:0000312|EMBL:AAF56598.2}
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Berkeley {ECO:0000269|PubMed:10731132};
PubMed=10731132; DOI=10.1126/science.287.5461.2185;
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
"The genome sequence of Drosophila melanogaster.";
Science 287:2185-2195(2000).
[5] {ECO:0000305, ECO:0000312|EMBL:AAF56598.2}
GENOME REANNOTATION, AND ALTERNATIVE SPLICING.
STRAIN=Berkeley;
PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
Lewis S.E.;
"Annotation of the Drosophila melanogaster euchromatic genome: a
systematic review.";
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
[6] {ECO:0000305, ECO:0000312|EMBL:AAL39806.2}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
STRAIN=Berkeley {ECO:0000312|EMBL:AAL39806.2}; TISSUE=Embryo;
Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J.W.,
Champe M., Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E.,
George R.A., Gonzalez M., Guarin H., Kronmiller B., Li P.W., Liao G.,
Miranda A., Mungall C.J., Nunoo J., Pacleb J.M., Paragas V., Park S.,
Patel S., Phouanenavong S., Wan K.H., Yu C., Lewis S.E., Rubin G.M.,
Celniker S.E.;
Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases.
[7] {ECO:0000305, ECO:0000312|EMBL:AAL25508.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1647-1851 (ISOFORMS
A/C/D/E/G/H).
STRAIN=Berkeley {ECO:0000269|PubMed:12537569};
TISSUE=Embryo {ECO:0000269|PubMed:12537569};
PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M.,
George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H.,
Rubin G.M., Celniker S.E.;
"A Drosophila full-length cDNA resource.";
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
[8] {ECO:0000305}
FUNCTION, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=10884224; DOI=10.1126/science.289.5476.113;
Bilder D., Li M., Perrimon N.;
"Cooperative regulation of cell polarity and growth by Drosophila
tumor suppressors.";
Science 289:113-116(2000).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-433; SER-435; SER-700;
SER-702; SER-705; SER-834; SER-837; SER-1031; SER-1041; SER-1475;
SER-1477; SER-1478 AND THR-1599, AND IDENTIFICATION BY MASS
SPECTROMETRY.
TISSUE=Embryo;
PubMed=18327897; DOI=10.1021/pr700696a;
Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.;
"Phosphoproteome analysis of Drosophila melanogaster embryos.";
J. Proteome Res. 7:1675-1682(2008).
-!- FUNCTION: Required for polarization of the embryonic, imaginal
disk and follicular epithelia. Specifically restricts apical
membrane determinants to the apical cell surface; acts to exclude
crb from the basolateral domain and define adherens junction
position. Regulates cellular growth and differentiation; acts as a
tumor suppressor. Essential for odor guided behavior.
{ECO:0000269|PubMed:10688207, ECO:0000269|PubMed:10884224,
ECO:0000269|PubMed:11578873, ECO:0000269|PubMed:12930751}.
-!- INTERACTION:
Q4AB30:gukh; NbExp=2; IntAct=EBI-419788, EBI-8282973;
-!- SUBCELLULAR LOCATION: Cytoplasm. Cell membrane; Peripheral
membrane protein. Cell junction, tight junction. Note=Localized to
epithelial septate junction at the boundary of the apical and
basolateral cell surfaces.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=11;
Name=D {ECO:0000269|PubMed:12930751};
IsoId=Q7KRY7-1; Sequence=Displayed;
Name=A {ECO:0000269|PubMed:11578873}; Synonyms=B
{ECO:0000303|PubMed:10731132}, Scrib1
{ECO:0000303|PubMed:11578873}, Vartul-1
{ECO:0000312|EMBL:CAB70601.1};
IsoId=Q7KRY7-2; Sequence=VSP_050879;
Name=C {ECO:0000269|PubMed:11578873}; Synonyms=Scrib2
{ECO:0000303|PubMed:11578873}, Vartul-2
{ECO:0000312|EMBL:CAB71137.1};
IsoId=Q7KRY7-3; Sequence=VSP_050880, VSP_050881;
Name=E {ECO:0000269|PubMed:12930751};
IsoId=Q7KRY7-4; Sequence=VSP_050877, VSP_050878, VSP_018595;
Name=F {ECO:0000269|PubMed:12930751};
IsoId=Q7KRY7-5; Sequence=VSP_050882, VSP_050883, VSP_050884;
Name=G {ECO:0000269|PubMed:12930751};
IsoId=Q7KRY7-6; Sequence=VSP_050876, VSP_050878, VSP_050882;
Name=H;
IsoId=Q7KRY7-7; Sequence=VSP_035210, VSP_018595;
Note=No experimental confirmation available.;
Name=I;
IsoId=Q7KRY7-8; Sequence=VSP_050883, VSP_050884;
Note=No experimental confirmation available.;
Name=J;
IsoId=Q7KRY7-9; Sequence=VSP_018595;
Name=K;
IsoId=Q7KRY7-10; Sequence=VSP_050879, VSP_042867;
Note=No experimental confirmation available.;
Name=P {ECO:0000312|FlyBase:FBgn0263289};
IsoId=Q7KRY7-11; Sequence=VSP_058487, VSP_058488, VSP_058489;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: During germ band extension, expression of
isoform A occurs predominantly in neuroblasts derived from the
neuro-ectoderm and later is restricted to CNS neurons and pole
cells. Isoform C is strongly expressed in PNS and a subset of CNS
neurons. In the adult, expressed in third antennal segment and
maxillary palps, major olfactory organs and in Johnstons organ in
the second antennal segment. Expression is also observed in
cortical regions of the brain. Isoforms expressed in epithelia are
coexpressed with dlg1 throughout development.
{ECO:0000269|PubMed:10884224, ECO:0000269|PubMed:11578873,
ECO:0000269|PubMed:12930751}.
-!- DEVELOPMENTAL STAGE: Expressed both zygotically and maternally in
embryos. Isoform A and isoform C have high expression throughout
embryonic development and very low expression in later
developmental stages. In adults, isoform A is a male-specific
isoform and isoform C a female specific.
{ECO:0000269|PubMed:10688207, ECO:0000269|PubMed:11578873,
ECO:0000269|PubMed:12930751}.
-!- DISRUPTION PHENOTYPE: Flies exhibit aberrant cell shape and loss
of the monolayer organization of embryonic epithelia creating a
corrugated cuticular surface that is riddled with holes hence the
gene name scribble. Misdistribution of apical proteins and
adherens junctions to the basolateral cell surface is also
exhibited. {ECO:0000269|PubMed:10688207}.
-!- SIMILARITY: Belongs to the LAP (LRR and PDZ) protein family.
{ECO:0000255}.
-!- SEQUENCE CAUTION:
Sequence=AAL25508.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF190774; AAF26357.2; -; mRNA.
EMBL; AJ252084; CAB70601.1; -; mRNA.
EMBL; AJ271647; CAB71137.1; -; mRNA.
EMBL; AY167903; AAO32791.1; -; mRNA.
EMBL; AY167904; AAO32792.1; -; mRNA.
EMBL; AY167905; AAO32793.1; -; mRNA.
EMBL; AY167906; AAO32794.1; -; mRNA.
EMBL; AE014297; AAF56598.2; -; Genomic_DNA.
EMBL; AE014297; AAN14076.1; -; Genomic_DNA.
EMBL; AE014297; AAN14077.2; -; Genomic_DNA.
EMBL; AE014297; AAN14078.1; -; Genomic_DNA.
EMBL; AE014297; AAX52995.2; -; Genomic_DNA.
EMBL; AE014297; AAX52996.1; -; Genomic_DNA.
EMBL; AE014297; ABI31210.3; -; Genomic_DNA.
EMBL; AE014297; AFH06635.1; -; Genomic_DNA.
EMBL; AY069661; AAL39806.2; -; mRNA.
EMBL; BT015240; AAT94469.1; -; mRNA.
EMBL; AY060469; AAL25508.1; ALT_SEQ; mRNA.
RefSeq; NP_001014669.1; NM_001014669.3. [Q7KRY7-8]
RefSeq; NP_001014670.2; NM_001014670.4. [Q7KRY7-7]
RefSeq; NP_001036761.3; NM_001043296.3. [Q7KRY7-2]
RefSeq; NP_001247318.1; NM_001260389.1. [Q7KRY7-10]
RefSeq; NP_524754.2; NM_080015.4. [Q7KRY7-1]
RefSeq; NP_733154.1; NM_170275.3. [Q7KRY7-2]
RefSeq; NP_733155.2; NM_170276.3. [Q7KRY7-11]
RefSeq; NP_733156.1; NM_170277.4. [Q7KRY7-3]
UniGene; Dm.16441; -.
ProteinModelPortal; Q7KRY7; -.
BioGrid; 69066; 43.
IntAct; Q7KRY7; 3.
MINT; MINT-1327318; -.
STRING; 7227.FBpp0300852; -.
iPTMnet; Q7KRY7; -.
PaxDb; Q7KRY7; -.
PeptideAtlas; Q7KRY7; -.
PRIDE; Q7KRY7; -.
EnsemblMetazoa; FBtr0308620; FBpp0300844; FBgn0263289. [Q7KRY7-2]
EnsemblMetazoa; FBtr0308621; FBpp0300845; FBgn0263289. [Q7KRY7-2]
EnsemblMetazoa; FBtr0308622; FBpp0300846; FBgn0263289. [Q7KRY7-7]
EnsemblMetazoa; FBtr0308623; FBpp0300847; FBgn0263289. [Q7KRY7-8]
EnsemblMetazoa; FBtr0308624; FBpp0300848; FBgn0263289. [Q7KRY7-3]
EnsemblMetazoa; FBtr0308625; FBpp0300849; FBgn0263289. [Q7KRY7-1]
EnsemblMetazoa; FBtr0308627; FBpp0300851; FBgn0263289. [Q7KRY7-10]
EnsemblMetazoa; FBtr0308632; FBpp0300856; FBgn0263289. [Q7KRY7-11]
GeneID; 44448; -.
KEGG; dme:Dmel_CG43398; -.
UCSC; CG5462-RB; d. melanogaster.
CTD; 23513; -.
FlyBase; FBgn0263289; scrib.
eggNOG; KOG0619; Eukaryota.
eggNOG; COG4886; LUCA.
GeneTree; ENSGT00840000129686; -.
InParanoid; Q7KRY7; -.
KO; K16175; -.
OrthoDB; EOG091G01EF; -.
PhylomeDB; Q7KRY7; -.
SignaLink; Q7KRY7; -.
ChiTaRS; scrib; fly.
GenomeRNAi; 44448; -.
PRO; PR:Q7KRY7; -.
Proteomes; UP000000803; Chromosome 3R.
Bgee; FBgn0263289; -.
ExpressionAtlas; Q7KRY7; differential.
Genevisible; Q7KRY7; DM.
GO; GO:0016327; C:apicolateral plasma membrane; IDA:FlyBase.
GO; GO:0016323; C:basolateral plasma membrane; IDA:FlyBase.
GO; GO:0005923; C:bicellular tight junction; IEA:UniProtKB-SubCell.
GO; GO:0005938; C:cell cortex; IDA:FlyBase.
GO; GO:0045169; C:fusome; IDA:FlyBase.
GO; GO:0016328; C:lateral plasma membrane; IDA:FlyBase.
GO; GO:0031594; C:neuromuscular junction; IDA:FlyBase.
GO; GO:0005918; C:septate junction; IDA:FlyBase.
GO; GO:0030714; P:anterior/posterior axis specification, follicular epithelium; IMP:BHF-UCL.
GO; GO:0045175; P:basal protein localization; IMP:FlyBase.
GO; GO:0060581; P:cell fate commitment involved in pattern specification; IMP:BHF-UCL.
GO; GO:0001708; P:cell fate specification; IMP:BHF-UCL.
GO; GO:0000902; P:cell morphogenesis; IMP:FlyBase.
GO; GO:0008283; P:cell proliferation; IMP:FlyBase.
GO; GO:0048749; P:compound eye development; IMP:FlyBase.
GO; GO:0007391; P:dorsal closure; IMP:FlyBase.
GO; GO:0045198; P:establishment of epithelial cell apical/basal polarity; IMP:FlyBase.
GO; GO:0001737; P:establishment of imaginal disc-derived wing hair orientation; IMP:FlyBase.
GO; GO:0042067; P:establishment of ommatidial planar polarity; IMP:FlyBase.
GO; GO:0035088; P:establishment or maintenance of apical/basal cell polarity; IMP:FlyBase.
GO; GO:0045197; P:establishment or maintenance of epithelial cell apical/basal polarity; TAS:FlyBase.
GO; GO:0016332; P:establishment or maintenance of polarity of embryonic epithelium; TAS:FlyBase.
GO; GO:0016334; P:establishment or maintenance of polarity of follicular epithelium; IMP:FlyBase.
GO; GO:0016336; P:establishment or maintenance of polarity of larval imaginal disc epithelium; IMP:FlyBase.
GO; GO:0045199; P:maintenance of epithelial cell apical/basal polarity; IBA:GO_Central.
GO; GO:0072002; P:Malpighian tubule development; IMP:FlyBase.
GO; GO:0007613; P:memory; IMP:FlyBase.
GO; GO:0001738; P:morphogenesis of a polarized epithelium; TAS:FlyBase.
GO; GO:0016331; P:morphogenesis of embryonic epithelium; TAS:FlyBase.
GO; GO:0016333; P:morphogenesis of follicular epithelium; IMP:FlyBase.
GO; GO:0016335; P:morphogenesis of larval imaginal disc epithelium; IMP:FlyBase.
GO; GO:0008285; P:negative regulation of cell proliferation; IMP:FlyBase.
GO; GO:0050680; P:negative regulation of epithelial cell proliferation; IMP:FlyBase.
GO; GO:0045571; P:negative regulation of imaginal disc growth; IMP:FlyBase.
GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; IMP:BHF-UCL.
GO; GO:0042048; P:olfactory behavior; IMP:FlyBase.
GO; GO:0030707; P:ovarian follicle cell development; IMP:BHF-UCL.
GO; GO:0007318; P:pole plasm protein localization; IMP:BHF-UCL.
GO; GO:0007464; P:R3/R4 cell fate commitment; IMP:FlyBase.
GO; GO:0051726; P:regulation of cell cycle; NAS:FlyBase.
GO; GO:0030100; P:regulation of endocytosis; IMP:FlyBase.
GO; GO:0042058; P:regulation of epidermal growth factor receptor signaling pathway; IMP:BHF-UCL.
GO; GO:0046425; P:regulation of JAK-STAT cascade; IMP:BHF-UCL.
GO; GO:0008593; P:regulation of Notch signaling pathway; IMP:BHF-UCL.
GO; GO:0050803; P:regulation of synapse structure or activity; IMP:FlyBase.
GO; GO:0007608; P:sensory perception of smell; IEA:UniProtKB-KW.
GO; GO:0019991; P:septate junction assembly; IMP:FlyBase.
GO; GO:0048863; P:stem cell differentiation; IMP:FlyBase.
GO; GO:0072089; P:stem cell proliferation; IMP:FlyBase.
GO; GO:0007472; P:wing disc morphogenesis; IMP:FlyBase.
GO; GO:0045186; P:zonula adherens assembly; IMP:FlyBase.
Gene3D; 3.80.10.10; -; 4.
InterPro; IPR001611; Leu-rich_rpt.
InterPro; IPR003591; Leu-rich_rpt_typical-subtyp.
InterPro; IPR032675; LRR_dom_sf.
InterPro; IPR001478; PDZ.
InterPro; IPR036034; PDZ_sf.
Pfam; PF13855; LRR_8; 3.
Pfam; PF00595; PDZ; 4.
SMART; SM00369; LRR_TYP; 13.
SMART; SM00228; PDZ; 4.
SUPFAM; SSF50156; SSF50156; 4.
SUPFAM; SSF52058; SSF52058; 2.
PROSITE; PS51450; LRR; 15.
PROSITE; PS50106; PDZ; 4.
1: Evidence at protein level;
Alternative splicing; Cell junction; Cell membrane; Coiled coil;
Complete proteome; Cytoplasm; Developmental protein; Differentiation;
Leucine-rich repeat; Membrane; Neurogenesis; Olfaction;
Phosphoprotein; Reference proteome; Repeat; Sensory transduction;
Tight junction.
CHAIN 1 1851 Protein lap4.
/FTId=PRO_0000188307.
REPEAT 38 59 LRR 1.
REPEAT 61 82 LRR 2.
REPEAT 84 105 LRR 3.
REPEAT 107 128 LRR 4.
REPEAT 130 152 LRR 5.
REPEAT 153 174 LRR 6.
REPEAT 176 197 LRR 7.
REPEAT 199 220 LRR 8.
REPEAT 222 243 LRR 9.
REPEAT 245 267 LRR 10.
REPEAT 268 289 LRR 11.
REPEAT 291 312 LRR 12.
REPEAT 314 335 LRR 13.
REPEAT 337 358 LRR 14.
REPEAT 360 382 LRR 15.
REPEAT 383 403 LRR 16.
DOMAIN 731 818 PDZ 1. {ECO:0000255|PROSITE-
ProRule:PRU00143}.
DOMAIN 929 1019 PDZ 2. {ECO:0000255|PROSITE-
ProRule:PRU00143}.
DOMAIN 1239 1329 PDZ 3. {ECO:0000255|PROSITE-
ProRule:PRU00143}.
DOMAIN 1336 1428 PDZ 4. {ECO:0000255|PROSITE-
ProRule:PRU00143}.
COILED 471 492 {ECO:0000255}.
COILED 677 693 {ECO:0000255}.
COILED 1753 1790 {ECO:0000255}.
COMPBIAS 128 397 Leu-rich.
COMPBIAS 868 882 Gln-rich.
MOD_RES 433 433 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 435 435 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 700 700 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 702 702 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 705 705 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 834 834 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 837 837 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 1031 1031 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 1041 1041 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 1475 1475 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 1477 1477 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 1478 1478 Phosphoserine.
{ECO:0000269|PubMed:18327897}.
MOD_RES 1599 1599 Phosphothreonine.
{ECO:0000269|PubMed:18327897}.
VAR_SEQ 97 137 Missing (in isoform G).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_050876.
VAR_SEQ 99 137 Missing (in isoform E).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_050877.
VAR_SEQ 427 427 P -> PDYPPMTLYRSSEKFDSTEFFSYQQK (in
isoform P). {ECO:0000305}.
/FTId=VSP_058487.
VAR_SEQ 446 1051 Missing (in isoform E and isoform G).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_050878.
VAR_SEQ 716 716 P -> PANQAMFNVKIKVKEGNNTLPRNGQRSNGNFSYSGA
GSGRNSPAMSSLRSSLASSNRSPSGSLQRKGKRVRIVTSYD
PIDRDYERQRQHY (in isoform H).
{ECO:0000305}.
/FTId=VSP_035210.
VAR_SEQ 1144 1238 Missing (in isoform A and isoform K).
{ECO:0000303|PubMed:10688207,
ECO:0000303|PubMed:11578873,
ECO:0000303|PubMed:12930751,
ECO:0000303|Ref.6}.
/FTId=VSP_050879.
VAR_SEQ 1238 1238 Missing (in isoform E, isoform H and
isoform J).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_018595.
VAR_SEQ 1239 1247 EVVLPKNQG -> VTISTSRIH (in isoform C).
{ECO:0000303|PubMed:11578873,
ECO:0000303|PubMed:12930751}.
/FTId=VSP_050880.
VAR_SEQ 1248 1851 Missing (in isoform C).
{ECO:0000303|PubMed:11578873,
ECO:0000303|PubMed:12930751}.
/FTId=VSP_050881.
VAR_SEQ 1468 1471 Missing (in isoform F and isoform G).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_050882.
VAR_SEQ 1697 1711 STPASRDGAEEQQEE -> VCTHLTVDARLLSWL (in
isoform F and isoform I).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_050883.
VAR_SEQ 1697 1704 STPASRDG -> LTAEQRIA (in isoform P).
{ECO:0000305}.
/FTId=VSP_058488.
VAR_SEQ 1705 1851 Missing (in isoform P). {ECO:0000305}.
/FTId=VSP_058489.
VAR_SEQ 1712 1851 Missing (in isoform F and isoform I).
{ECO:0000303|PubMed:12930751}.
/FTId=VSP_050884.
VAR_SEQ 1839 1851 RNPLDEIEAVFRS -> SAEKRASWRAARLRSLEQGAVEAQ
DVIKNMRKMTDDLITHESRASEVETCKERIISLELQVPETE
DEGKLDDTQPPLELEADDFQDDEDDDDDDDDEDDFEDEDEE
EDTASIVTVQANNEKLFLRHDSDTYGPSSIESVASGKVRIK
PTPLSLHQTLAKETTIVEVLNPVIGGDGSARTIHVSGGLPF
DEDAFEQGAVAVLRSETFVLPGAAGGGRSELSLNAKMKTVL
EELLENERVKLNLQKSLEGEEGEDDDDEDENGSAYGDARDE
EESAYGDAIDDVVDFGSATVTSRAANDKDDVKNGNQQLLEE
LIKDSNRNTIIAKLAGQLSDDDEEDDDEEESSDSSDDDSDD
SDEEDNAQQQLNVTYVQGAQVIENLNTLATGGKLQKSQTYT
AIKQAEEPKEEDTKLEEDPSAEKPCGADTLAKLQAEQRALA
EISKQLRKSVEDLLSADGETVVETQRTYTLPAPSDSSAVVT
VTEVVKKQKKKKSETGEELFNRLLNAAESERQVFDRQQGET
ITTTTTTTEAVSSEDNEPSTSVVTTTRTVSNIVTSGIPRPE
TSKQNNRSSSSSNSNSSNNNRNKNKRKGKKK (in
isoform K). {ECO:0000305}.
/FTId=VSP_042867.
CONFLICT 19 19 D -> N (in Ref. 2; CAB70601/CAB71137 and
3; AAO32791/AAO32792/AAO32794).
{ECO:0000305}.
CONFLICT 40 40 E -> K (in Ref. 2; CAB70601/CAB71137 and
3; AAO32791/AAO32792/AAO32794).
{ECO:0000305}.
CONFLICT 262 262 G -> D (in Ref. 6; AAT94469).
{ECO:0000305}.
CONFLICT 313 313 T -> I (in Ref. 6; AAT94469).
{ECO:0000305}.
CONFLICT 1108 1108 S -> T (in Ref. 2; CAB70601/CAB71137 and
3; AAO32791/AAO32792/AAO32793/AAO32794).
{ECO:0000305}.
CONFLICT 1239 1239 Missing (in Ref. 3; AAO32791/AAO32792).
{ECO:0000305}.
CONFLICT 1326 1326 Q -> P (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32793/AAO32794).
{ECO:0000305}.
CONFLICT 1340 1340 S -> N (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32793/AAO32794).
{ECO:0000305}.
CONFLICT 1361 1361 N -> Y (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32793/AAO32794).
{ECO:0000305}.
CONFLICT 1388 1388 K -> Q (in Ref. 1; AAF26357).
{ECO:0000305}.
CONFLICT 1540 1540 A -> P (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32793/AAO32794).
{ECO:0000305}.
CONFLICT 1688 1688 D -> Y (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32793/AAO32794).
{ECO:0000305}.
CONFLICT 1700 1700 A -> S (in Ref. 7; AAL25508).
{ECO:0000305}.
CONFLICT 1741 1741 K -> R (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32794).
{ECO:0000305}.
CONFLICT 1769 1769 I -> F (in Ref. 2; CAB70601 and 3;
AAO32791/AAO32792/AAO32794).
{ECO:0000305}.
CONFLICT 1833 1833 D -> V (in Ref. 6; AAL39806).
{ECO:0000305}.
SEQUENCE 1851 AA; 200440 MW; B744F9BA3827742C CRC64;
MFKCIPIFKG CNRQVEFVDK RHCSLPQVPE EILRYSRTLE ELFLDANHIR DLPKNFFRLH
RLRKLGLSDN EIGRLPPDIQ NFENLVELDV SRNDIPDIPD DIKHLQSLQV ADFSSNPIPK
LPSGFSQLKN LTVLGLNDMS LTTLPADFGS LTQLESLELR ENLLKHLPET ISQLTKLKRL
DLGDNEIEDL PPYLGYLPGL HELWLDHNQL QRLPPELGLL TKLTYLDVSE NRLEELPNEI
SGLVSLTDLD LAQNLLEALP DGIAKLSRLT ILKLDQNRLQ RLNDTLGNCE NMQELILTEN
FLSELPASIG QMTKLNNLNV DRNALEYLPL EIGQCANLGV LSLRDNKLKK LPPELGNCTV
LHVLDVSGNQ LLYLPYSLVN LQLKAVWLSE NQSQPLLTFQ PDTDAETGEQ VLSCYLLPQQ
EYQPITPARD LESDSEPFEE REPSRTVVKF SEEATQEKET PFVRQNTPHP KDLKAKAQKL
KVERSRNEEH ANLVTLPEEN GTKLAETPTE TRTIANNHQQ QPHPVQQPIV GVNSKQPVVV
GVVTPTTTTV APTGVQGGSE GASSTANNVK AATAAVVAEL AATVGGSDEV QDDDEQEDEF
ESDRRVGFQV EGEDDDFYKR PPKLHRRDTP HHLKNKRVQH LTDKQASEIL ANALASQERN
DTTPQHSLSG KVTSPIEEEE QLEVEQEQQQ QQQQHPFDSS LSPISAGKTA EASTDPDNLD
GVTELRLEQY EIHIERTAAG LGLSIAGGKG STPFKGDDDG IFISRVTEAG PADLAGLKVG
DKVIKVNGIV VVDADHYQAV QVLKACGAVL VLVVQREVTR LIGHPVFSED GSVSQISVET
RPLVADAPPA ASISHERYIP APIEIVPQQQ HLQQQQQQPI QQVAPTHSYS GNVFATPTAA
QTVQPAVSAA PNGLLLNGRE APLSYIQLHT TLIRDQIGQG LGFSIAGGKG SPPFKDDCDG
IFISRITEGG LAYRDGKIMV GDRVMAINGN DMTEAHHDAA VACLTEPQRF VRLVLQREYR
GPLEPPTSPR SPAVLNSLSP SGYLANRPAN FSRSVVEVEQ PYKYNTLATT TPTPKPTVPA
SISNNNNTLP SSKTNGFATA AAATIDSSTG QPVPAPRRTN SVPMGDGDIG AGSTTSGDSG
EAQPSSLRPL TSDDFQAMIP AHFLSGGSQH QVHVARPNEV GVSAVTVNVN KPQPDLPMFP
AAPTELGRVT ETITKSTFTE TVMTRITDNQ LAEPLISEEV VLPKNQGSLG FSIIGGTDHS
CVPFGTREPG IFISHIVPGG IASKCGKLRM GDRILKVNEA DVSKATHQDA VLELLKPGDE
IKLTIQHDPL PPGFQEVLLS KAEGERLGMH IKGGLNGQRG NPADPSDEGV FVSKINSVGA
ARRDGRLKVG MRLLEVNGHS LLGASHQDAV NVLRNAGNEI QLVVCKGYDK SNLIHSIGQA
GGMSTGFNSS ASCSGGSRQG SRASETGSEL SQSQSVSSLD HEEDERLRQD FDVFASQKPD
AQQPTGPSVL AAAAAMVHGA SSPTPPAATS NITPLPTAAA VASADLTAPD TPATQTVALI
HAEQQAHQQQ QQTQLAPLGQ EKSTQEKVLE IVRAADAFTT VPPKSPSEHH EQDKIQKTTT
VVISKHTLDT NPTTPTTPAA PLSIAGAESA NSAGAPSPAV PASTPGSAPV LPAVAVQTQT
QTTSTEKDEE EESQLQSTPA SRDGAEEQQE EVRAKPTPTK VPKSVSDKKR FFESAMEDQH
KPTQKTDKVF SFLSKDEVEK LRQEEERKIA TLRRDKNSRL LDAANDNIDK DAAQQRTKSN
SNSSSGDDND DSDQEEGIAR GDSVDNAALG HFDDAEDMRN PLDEIEAVFR S


Related products :

Catalog number Product name Quantity
EIAAB37671 CRIB1,Homo sapiens,hScrib,Human,KIAA0147,LAP4,Protein LAP4,Protein scribble homolog,SCRB1,SCRIB,Scribble,VARTUL
EIAAB37670 Kiaa0147,Lap4,Mouse,Mus musculus,Protein LAP4,Protein scribble homolog,Scrib,Scrib1,Scribble
Y030013 hScrib | Protein LAP4 100ul
AS06 155 hScrib | Protein LAP4 100 ul
AS06155 hScrib | Protein LAP4 100 ul
Y030013 hScrib | Protein LAP4 Antibody 100ul
Y030013 hScrib | Protein LAP4 antibody 250ug
AS06 155 rabbit polyclonal hScrib | Protein LAP4 100
CSB-EL020858MO Mouse Protein scribble homolog(SCRIB) ELISA kit 96T
CSB-EL020858HU Human Protein scribble homolog(SCRIB) ELISA kit 96T
G4120 Protein scribble homolog (SCRIB), Mouse, ELISA Kit 96T
G4119 Protein scribble homolog (SCRIB), Human, ELISA Kit 96T
AS06 155 Antibody: hScrib | Protein LAP4 , Host: rabbit, polyclonal, Comfirmed reactivity: human 100
CSB-EL020858HU Human Protein scribble homolog(SCRIB) ELISA kit SpeciesHuman 96T
CSB-EL020858MO Mouse Protein scribble homolog(SCRIB) ELISA kit SpeciesMouse 96T
SCRIB_HUMAN ELISA Kit FOR Protein scribble homolog; organism: Human; gene name: SCRIB 96T
SCRIB_MOUSE ELISA Kit FOR Protein scribble homolog; organism: Mouse; gene name: Scrib 96T
orb82802 Mouse IL13 protein IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL13 in mice resulted in impaired Th2 cell 1 mg
orb84793 IL13 protein IL13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL13 in mice resulted in impaired Th2 cell develo 10
PAH-G1-2 Protein Arrays containing 234 Human Protein for simultaneous detection of Protein function, including Protein-protein interaction, Protein modification, antibody specificity, auto-antibody and small m 1 glass slide with 2 sub-arrays
29-844 RNF40 contains a RING finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein was reported to interact with the tumor suppressor protein RB1. Studies of the 0.1 mg
29-850 The protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this 0.1 mg
EIAAB10617 DCN1-like protein 1,DCUN1 domain-containing protein 1,Dcun1d1,Dcun1l1,Defective in cullin neddylation protein 1-like protein 1,Mouse,Mus musculus,Rp42,Tes3,Testis-specific protein 3
EIAAB44668 Dap12,DNAX-activation protein 12,Karap,KAR-associated protein,Killer-activating receptor-associated protein,Mouse,Mus musculus,TYRO protein tyrosine kinase-binding protein,Tyrobp
EIAAB44667 DAP12,DNAX-activation protein 12,Homo sapiens,Human,KARAP,KAR-associated protein,Killer-activating receptor-associated protein,TYRO protein tyrosine kinase-binding protein,TYROBP


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur