Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein male abnormal 3

 MAB3_CAEEL              Reviewed;         290 AA.
O18214; Q8I0Z0;
08-DEC-2000, integrated into UniProtKB/Swiss-Prot.
01-JAN-1998, sequence version 1.
12-SEP-2018, entry version 126.
RecName: Full=Protein male abnormal 3;
Name=mab-3; ORFNames=Y53C12B.5;
Caenorhabditis elegans.
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
NCBI_TaxID=6239;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM A), FUNCTION, AND
DEVELOPMENTAL STAGE.
STRAIN=Bristol N2;
PubMed=9490411; DOI=10.1038/35618;
Raymond C.S., Shamu C.E., Shen M.M., Seifert K.J., Hirsch B.,
Hodgkin J., Zarkower D.;
"Evidence for evolutionary conservation of sex-determining genes.";
Nature 391:691-695(1998).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND ALTERNATIVE
SPLICING.
STRAIN=Bristol N2;
PubMed=9851916; DOI=10.1126/science.282.5396.2012;
The C. elegans sequencing consortium;
"Genome sequence of the nematode C. elegans: a platform for
investigating biology.";
Science 282:2012-2018(1998).
-!- FUNCTION: Promotes male-specific development of two tissues. In
the peripheral nervous system, directs differentiation of sensory
ray neuroblasts into peripheral sense organs. In the intestine,
causes repression of vitellogenin gene transcription. Binds the
DNA motif 5'-[CGA][TCA][TA]ACAATGT[AT][TGA]C-3', probably as a
monomer. {ECO:0000269|PubMed:9490411}.
-!- INTERACTION:
Q10666:pop-1; NbExp=3; IntAct=EBI-2420993, EBI-317870;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-
ProRule:PRU00070}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=a;
IsoId=O18214-1; Sequence=Displayed;
Name=b;
IsoId=O18214-2; Sequence=VSP_015559, VSP_015560;
Note=No experimental confirmation available.;
-!- DEVELOPMENTAL STAGE: Expressed in late larvae of both sexes. In
the fourth larval stage, expression is approximately six-fold
higher in males than in hermaphrodites. In adults, expression is
undetectable in XX hermaphrodites, but persists in XO males.
{ECO:0000269|PubMed:9490411}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF022388; AAC38956.1; -; Genomic_DNA.
EMBL; Z99278; CAB16489.1; -; Genomic_DNA.
EMBL; Z99278; CAD59170.1; -; Genomic_DNA.
PIR; T27132; T27132.
RefSeq; NP_001022464.1; NM_001027293.1. [O18214-1]
RefSeq; NP_871909.2; NM_182109.4.
UniGene; Cel.14693; -.
ProteinModelPortal; O18214; -.
SMR; O18214; -.
IntAct; O18214; 55.
STRING; 6239.Y53C12B.5a; -.
PaxDb; O18214; -.
EnsemblMetazoa; Y53C12B.5a; Y53C12B.5a; WBGene00003100. [O18214-1]
GeneID; 174533; -.
KEGG; cel:CELE_Y53C12B.5; -.
UCSC; Y53C12B.5a; c. elegans. [O18214-1]
CTD; 174533; -.
WormBase; Y53C12B.5a; CE14902; WBGene00003100; mab-3. [O18214-1]
WormBase; Y53C12B.5b; CE51560; WBGene00003100; mab-3.
eggNOG; KOG3815; Eukaryota.
eggNOG; ENOG410XSK9; LUCA.
GeneTree; ENSGT00900000142474; -.
HOGENOM; HOG000016185; -.
InParanoid; O18214; -.
OMA; RCLNHGE; -.
OrthoDB; EOG091G0PSC; -.
SignaLink; O18214; -.
PRO; PR:O18214; -.
Proteomes; UP000001940; Chromosome II.
Bgee; WBGene00003100; Expressed in 3 organ(s), highest expression level in multi-cellular organism.
GO; GO:0005634; C:nucleus; IC:WormBase.
GO; GO:0003700; F:DNA-binding transcription factor activity; IEA:InterPro.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0000978; F:RNA polymerase II proximal promoter sequence-specific DNA binding; IDA:WormBase.
GO; GO:0001012; F:RNA polymerase II regulatory region DNA binding; IDA:WormBase.
GO; GO:0030154; P:cell differentiation; IEA:UniProtKB-KW.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IMP:WormBase.
GO; GO:0045138; P:nematode male tail tip morphogenesis; IMP:WormBase.
GO; GO:0010628; P:positive regulation of gene expression; IGI:WormBase.
GO; GO:0007548; P:sex differentiation; IMP:WormBase.
Gene3D; 4.10.1040.10; -; 2.
InterPro; IPR001275; DM_DNA-bd.
InterPro; IPR036407; DM_DNA-bd_sf.
InterPro; IPR026607; DMRT/dsx/mab-3.
PANTHER; PTHR12322; PTHR12322; 2.
Pfam; PF00751; DM; 2.
SMART; SM00301; DM; 2.
SUPFAM; SSF82927; SSF82927; 2.
PROSITE; PS40000; DM_1; 2.
PROSITE; PS50809; DM_2; 2.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Developmental protein;
Differentiation; DNA-binding; Metal-binding; Nucleus;
Reference proteome; Repeat; Sexual differentiation; Zinc.
CHAIN 1 290 Protein male abnormal 3.
/FTId=PRO_0000207051.
DNA_BIND 28 74 DM 1. {ECO:0000255|PROSITE-
ProRule:PRU00070}.
DNA_BIND 94 142 DM 2. {ECO:0000255|PROSITE-
ProRule:PRU00070}.
COMPBIAS 183 209 Pro/Ser-rich.
COMPBIAS 238 241 Poly-Gln.
VAR_SEQ 1 133 Missing (in isoform b). {ECO:0000305}.
/FTId=VSP_015559.
VAR_SEQ 281 290 MYLKNYGLQA -> IKIVCFPSLLNFPHNLFLSLVSNSMIF
SYFLEFSLFTNFVIFSNFFIHFSPSEPTNLPIFFSSSRPLV
LFQKSPFFLNSNNLFVSHQTTYYLSMSLRHLIMSSISSKIP
KFHRYSSVCIDFPLSPPKLS (in isoform b).
{ECO:0000305}.
/FTId=VSP_015560.
SEQUENCE 290 AA; 32463 MW; 2F324FFB0B8846D5 CRC64;
MLTEDPVSEI CEAKAVDELA EQEKNYYCQR CLNHGELKPR KGHKPDCRYL KCPCRECTMV
EQRRQLNNLL SKKKIHCTPA TQTRDGKRVR DPHCARCSAH GVLVPLRGHK RTMCQFVTCE
CTLCTLVEHR RNLMAAQIKL RRSQQKSRDG KEPKRNSRRK SKDMDMEMMV VTATDGQKII
GTSASPSPSS TTDTMSPSLS MSPPCSPSPL LAQYTLTLAA PIPIYPPIPM NQQLISLQQQ
QFLMSIIQNM APSIGQQAPL LPGISAGSVS SAAILNEFWS MYLKNYGLQA


Related products :

Catalog number Product name Quantity
EIAAB25469 Homo sapiens,Human,Male-specific lethal-3 homolog 2,Male-specific lethal-3 homolog pseudogene 1,MSL3L2,MSL3-like 2,MSL3P1,Putative male-specific lethal-3 protein-like 2
EIAAB25504 Homo sapiens,Human,KIAA1585,Male-specific lethal 2 homolog,Male-specific lethal 2-like 1,Male-specific lethal-2 homolog 1,MSL2,MSL-2,MSL2L1,MSL2-like 1,RING finger protein 184,RNF184
EIAAB25503 Kiaa1585,Male-specific lethal 2 homolog,Male-specific lethal 2-like 1,Male-specific lethal-2 homolog 1,Mouse,Msl2,MSL-2,Msl2l1,MSL2-like 1,Mus musculus,RING finger protein 184,Rnf184
EIAAB25467 Male-specific lethal 3 homolog,Male-specific lethal-3 homolog 1,Male-specific lethal-3 protein-like 1,Mouse,Msl3,Msl31,Msl3l1,MSL3-like 1,Mus musculus
EIAAB25468 Homo sapiens,Human,Male-specific lethal 3 homolog,Male-specific lethal-3 homolog 1,Male-specific lethal-3 protein-like 1,MSL3,MSL3L1,MSL3-like 1
Y050800 Anti_daf_2(Abnormal dauer formation protein 2) 100ug
CSB-EL002229CA Cat Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit 96T
CSB-EL002229DO Dog Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit 96T
Y050800 Anti-daf-2(Abnormal dauer formation protein 2) Antibody 100ug
AE55319CA Cat Abnormal spindle-like microcephaly-associated protein (ASPM) ELISA Kit 48T
CSB-EL002229CA Cat Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit SpeciesCat 96T
E1266p Mouse ELISA Kit FOR Spindle assembly abnormal protein 6 homolog 96T
E1653b Human ELISA Kit FOR Spindle assembly abnormal protein 6 homolog 96T
CSB-EL002229BO Bovine Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit 96T
CSB-EL002229HU Human Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit 96T
CSB-EL002229MO Mouse Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit 96T
E1041m Bovine ELISA Kit FOR Abnormal spindle-like microcephaly-associated protein homolog 96T
AE55316MO Mouse Abnormal spindle-like microcephaly-associated protein (ASPM) ELISA Kit 48T
CSB-EL002229DO Dog Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit SpeciesDog 96T
CSB-EL002229SH Sheep Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit SpeciesSheep 96T
CSB-EL020716MO Mouse Spindle assembly abnormal protein 6 homolog(SASS6) ELISA kit 96T
CSB-EL002229MO Mouse Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit SpeciesMouse 96T
CSB-EL020716CH Chicken Spindle assembly abnormal protein 6 homolog(SASS6) ELISA kit 96T
CSB-EL002229BO Bovine Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit SpeciesBovine 96T
CSB-EL002229HU Human Abnormal spindle-like microcephaly-associated protein(ASPM) ELISA kit SpeciesHuman 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur