Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein white

 WHITE_DROME             Reviewed;         687 AA.
P10090; Q9V3A2; Q9XY33;
01-JUL-1989, integrated into UniProtKB/Swiss-Prot.
01-NOV-1991, sequence version 2.
18-JUL-2018, entry version 169.
RecName: Full=Protein white;
Name=w; ORFNames=CG2759;
Drosophila melanogaster (Fruit fly).
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
Ephydroidea; Drosophilidae; Drosophila; Sophophora.
NCBI_TaxID=7227;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
TISSUE=Head;
PubMed=2109311; DOI=10.1093/nar/18.6.1633;
Pepling M., Mount S.M.;
"Sequence of a cDNA from the Drosophila melanogaster white gene.";
Nucleic Acids Res. 18:1633-1633(1990).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=6084717; DOI=10.1016/0022-2836(84)90021-4;
O'Hare K., Murphy C., Levis R., Rubin G.M.;
"DNA sequence of the white locus of Drosophila melanogaster.";
J. Mol. Biol. 180:437-455(1984).
[3]
SEQUENCE REVISION TO 25-29 AND 616.
O'Hare K.;
Submitted (MAY-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=11156992;
Lukacsovich T., Asztalos Z., Awano W., Baba K., Kondo S., Niwa S.,
Yamamoto D.;
"Dual-tagging gene trap of novel genes in Drosophila melanogaster.";
Genetics 157:727-742(2001).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Berkeley;
PubMed=10731132; DOI=10.1126/science.287.5461.2185;
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
"The genome sequence of Drosophila melanogaster.";
Science 287:2185-2195(2000).
[6]
GENOME REANNOTATION.
STRAIN=Berkeley;
PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
Lewis S.E.;
"Annotation of the Drosophila melanogaster euchromatic genome: a
systematic review.";
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Oregon-R;
PubMed=10731137; DOI=10.1126/science.287.5461.2220;
Benos P.V., Gatt M.K., Ashburner M., Murphy L., Harris D.,
Barrell B.G., Ferraz C., Vidal S., Brun C., Demailles J., Cadieu E.,
Dreano S., Gloux S., Lelaure V., Mottier S., Galibert F., Borkova D.,
Minana B., Kafatos F.C., Louis C., Siden-Kiamos I., Bolshakov S.,
Papagiannakis G., Spanos L., Cox S., Madueno E., de Pablos B.,
Modolell J., Peter A., Schoettler P., Werner M., Mourkioti F.,
Beinert N., Dowe G., Schaefer U., Jaeckle H., Bucheton A.,
Callister D.M., Campbell L.A., Darlamitsou A., Henderson N.S.,
McMillan P.J., Salles C., Tait E.A., Valenti P., Saunders R.D.C.,
Glover D.M.;
"From sequence to chromosome: the tip of the X chromosome of D.
melanogaster.";
Science 287:2220-2222(2000).
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 224-331.
PubMed=2503416;
Tearle R.G., Belote J.M., McKeown M., Baker B.S., Howells A.J.;
"Cloning and characterization of the scarlet gene of Drosophila
melanogaster.";
Genetics 122:595-606(1989).
[9]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=11294610; DOI=10.1023/A:1004115718597;
Mackenzie S.M., Howells A.J., Cox G.B., Ewart G.D.;
"Sub-cellular localisation of the white/scarlet ABC transporter to
pigment granule membranes within the compound eye of Drosophila
melanogaster.";
Genetica 108:239-252(2000).
-!- FUNCTION: Part of a membrane-spanning permease system necessary
for the transport of pigment precursors into pigment cells
responsible for eye color. White dimerize with brown for the
transport of guanine. Scarlet and white complex transports a
metabolic intermediate (such as 3-hydroxy kynurenine) from the
cytoplasm into the pigment granules.
{ECO:0000269|PubMed:11294610}.
-!- SUBUNIT: Heterodimer of white with either brown or scarlet.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:11294610};
Multi-pass membrane protein {ECO:0000269|PubMed:11294610}.
Cytoplasmic granule membrane {ECO:0000269|PubMed:11294610}; Multi-
pass membrane protein {ECO:0000269|PubMed:11294610}. Note=Pigment
granules within pigment cells and retinula cells of the compound
eye (when complexed with st).
-!- SIMILARITY: Belongs to the ABC transporter superfamily. ABCG
family. Eye pigment precursor importer (TC 3.A.1.204) subfamily.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X51749; CAA36038.1; -; mRNA.
EMBL; X02974; CAA26716.2; -; Genomic_DNA.
EMBL; AB028139; BAA78210.1; -; Genomic_DNA.
EMBL; AE014298; AAF45826.1; -; Genomic_DNA.
EMBL; AL133506; CAB65847.1; -; Genomic_DNA.
EMBL; X76202; CAA53795.1; -; Genomic_DNA.
PIR; S08635; FYFFW.
RefSeq; NP_476787.1; NM_057439.2.
UniGene; Dm.19661; -.
ProteinModelPortal; P10090; -.
SMR; P10090; -.
BioGrid; 57802; 81.
DIP; DIP-388N; -.
IntAct; P10090; 4.
STRING; 7227.FBpp0070468; -.
TCDB; 3.A.1.204.1; the atp-binding cassette (abc) superfamily.
PaxDb; P10090; -.
PRIDE; P10090; -.
GeneID; 31271; -.
KEGG; dme:Dmel_CG2759; -.
CTD; 31271; -.
FlyBase; FBgn0003996; w.
eggNOG; KOG0061; Eukaryota.
eggNOG; COG1131; LUCA.
InParanoid; P10090; -.
KO; K21396; -.
OrthoDB; EOG091G05L3; -.
PhylomeDB; P10090; -.
ChiTaRS; w; fly.
GenomeRNAi; 31271; -.
PRO; PR:P10090; -.
Proteomes; UP000000803; Chromosome X.
Bgee; FBgn0003996; -.
ExpressionAtlas; P10090; baseline and differential.
Genevisible; P10090; DM.
GO; GO:0031410; C:cytoplasmic vesicle; IDA:FlyBase.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0090740; C:integral component of pigment granule membrane; IDA:FlyBase.
GO; GO:0048770; C:pigment granule; IDA:FlyBase.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0098793; C:presynapse; IEA:GOC.
GO; GO:1905948; F:3',5'-cyclic GMP transmembrane-transporting ATPase activity; IMP:FlyBase.
GO; GO:0005275; F:amine transmembrane transporter activity; IMP:FlyBase.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0005395; F:eye pigment precursor transporter activity; IMP:FlyBase.
GO; GO:0008558; F:guanine-transporting ATPase activity; IMP:FlyBase.
GO; GO:0031409; F:pigment binding; IEA:UniProtKB-KW.
GO; GO:0015842; P:aminergic neurotransmitter loading into synaptic vesicle; IMP:FlyBase.
GO; GO:0042401; P:cellular biogenic amine biosynthetic process; IMP:FlyBase.
GO; GO:0070731; P:cGMP transport; IMP:FlyBase.
GO; GO:0048072; P:compound eye pigmentation; IMP:FlyBase.
GO; GO:0042441; P:eye pigment metabolic process; TAS:FlyBase.
GO; GO:0006856; P:eye pigment precursor transport; IEP:FlyBase.
GO; GO:0042332; P:gravitaxis; IMP:FlyBase.
GO; GO:0051615; P:histamine uptake; IGI:FlyBase.
GO; GO:0008049; P:male courtship behavior; IMP:FlyBase.
GO; GO:0007613; P:memory; IMP:FlyBase.
GO; GO:0006727; P:ommochrome biosynthetic process; IMP:FlyBase.
GO; GO:0055085; P:transmembrane transport; IMP:FlyBase.
InterPro; IPR003593; AAA+_ATPase.
InterPro; IPR013525; ABC_2_trans.
InterPro; IPR003439; ABC_transporter-like.
InterPro; IPR017871; ABC_transporter_CS.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR005284; Pigment_permease/Abcg.
Pfam; PF01061; ABC2_membrane; 1.
Pfam; PF00005; ABC_tran; 1.
SMART; SM00382; AAA; 1.
SUPFAM; SSF52540; SSF52540; 1.
TIGRFAMs; TIGR00955; 3a01204; 1.
PROSITE; PS00211; ABC_TRANSPORTER_1; 1.
PROSITE; PS50893; ABC_TRANSPORTER_2; 1.
2: Evidence at transcript level;
ATP-binding; Complete proteome; Membrane; Nucleotide-binding; Pigment;
Reference proteome; Transmembrane; Transmembrane helix; Transport.
CHAIN 1 687 Protein white.
/FTId=PRO_0000093382.
TRANSMEM 435 453 Helical. {ECO:0000255}.
TRANSMEM 465 485 Helical. {ECO:0000255}.
TRANSMEM 515 533 Helical. {ECO:0000255}.
TRANSMEM 542 563 Helical. {ECO:0000255}.
TRANSMEM 576 594 Helical. {ECO:0000255}.
TRANSMEM 659 678 Helical. {ECO:0000255}.
DOMAIN 93 341 ABC transporter. {ECO:0000255|PROSITE-
ProRule:PRU00434}.
NP_BIND 130 137 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00434}.
CONFLICT 25 29 GDSGA -> LIFEIPYHCRVTAD (in Ref. 4;
BAA78210). {ECO:0000305}.
CONFLICT 49 49 L -> R (in Ref. 5; AAF45826 and 7;
CAB65847). {ECO:0000305}.
CONFLICT 335 371 VGAQCPTNYNPADFYVQVLAVVPGREIESRDRIAKIC ->
ITLHLNSYPAWVPSVLPTTIRRTFTYRCWPLCPDGRSSPVI
GSPRYG (in Ref. 4; BAA78210).
{ECO:0000305}.
CONFLICT 616 616 G -> A (in Ref. 2; CAA26716).
{ECO:0000305}.
SEQUENCE 687 AA; 75673 MW; 24AFAD799DE0D396 CRC64;
MGQEDQELLI RGGSKHPSAE HLNNGDSGAA SQSCINQGFG QAKNYGTLLP PSPPEDSGSG
SGQLAENLTY AWHNMDIFGA VNQPGSGWRQ LVNRTRGLFC NERHIPAPRK HLLKNVCGVA
YPGELLAVMG SSGAGKTTLL NALAFRSPQG IQVSPSGMRL LNGQPVDAKE MQARCAYVQQ
DDLFIGSLTA REHLIFQAMV RMPRHLTYRQ RVARVDQVIQ ELSLSKCQHT IIGVPGRVKG
LSGGERKRLA FASEALTDPP LLICDEPTSG LDSFTAHSVV QVLKKLSQKG KTVILTIHQP
SSELFELFDK ILLMAEGRVA FLGTPSEAVD FFSYVGAQCP TNYNPADFYV QVLAVVPGRE
IESRDRIAKI CDNFAISKVA RDMEQLLATK NLEKPLEQPE NGYTYKATWF MQFRAVLWRS
WLSVLKEPLL VKVRLIQTTM VAILIGLIFL GQQLTQVGVM NINGAIFLFL TNMTFQNVFA
TINVFTSELP VFMREARSRL YRCDTYFLGK TIAELPLFLT VPLVFTAIAY PMIGLRAGVL
HFFNCLALVT LVANVSTSFG YLISCASSST SMALSVGPPV IIPFLLFGGF FLNSGSVPVY
LKWLSYLSWF RYANEGLLIN QWADVEPGEI SCTSSNTTCP SSGKVILETL NFSAADLPLD
YVGLAILIVS FRVLAYLALR LRARRKE


Related products :

Catalog number Product name Quantity
P-06710 PETROLEUM JELLY WHITE (Paraffin Soft white) (Vaseline White) CAS: 8009-03-8 5 kg
V-09398 VASELINE WHITE (Paraffin Soft White, Petroleum Jelly White ) CAS: 8009-03-8 500 gm
V-09398 VASELINE WHITE (Paraffin Soft White, Petroleum Jelly White ) CAS: 8009-03-8 5 kg
P-06710 PETROLEUM JELLY WHITE (Paraffin Soft white) (Vaseline White) CAS: 8009-03-8 500 gm
orb81138 Ganciclovir protein Ganciclovir is white to off-white crystalline powder with molecular formula of C9H13N504 and molecular weight of 255.23. For research use only. 100 mg
142226 B30 White Tag B-551 _ B30 White Tag B-551 AF Systems Consumables;Pack-Roll; Width 82.55 Height 146.05 100 Pcs Per Pack
1625-1000 Imatinib Mesylate (CGP-57148B, STI-571); Appearance White to off-white solid 1 g
1588-1000 Erlotinib, Hydrochloride Salt; Appearance White to off-white solid 1 g
1860-1000 Puromycin Dihydrochloride; Appearance White to off-white solid 1 g
9333-0LW Vial, 3 ml., White Glass, w_Perforated White Plastic Screwcap 1000 pcs
1625-100 Imatinib Mesylate (CGP-57148B, STI-571); Appearance White to off-white solid 100 mg
9444-0LW Vial, 4 ml., White Glass, w_Perforated White Plastic Screwcap 1000 pcs
1586-25 Dasatinib (BMS-354825, Sprycel); Appearance White to off-white solid 25 mg
1566-5 Ionomycin (Calcium salt); Appearance White to off-white solid 5 mg
1588-100 Erlotinib, Hydrochloride Salt; Appearance White to off-white solid 100 mg
1883-1000 Deferoxamine Mesylate; Appearance White to off-white solid 1 g
1874-250 Suramin Hexasodium Salt; Appearance White to off-white solid 250 mg
9011-0LW Vial, 1 ml., White Glass, w_Perforated White Plastic Screwcap 1000 pcs
9022-0LW Vial, 2 ml., White Glass, w_Perforated White Plastic Screwcap 1000 pcs
1586-100 Dasatinib (BMS-354825, Sprycel); Appearance White to off-white solid 100 mg
1659-1 Hh Signaling Pathway Antagonist; Appearance White to off-white solid 1 mg
1874-50 Suramin Hexasodium Salt; Appearance White to off-white solid 50 mg
1782-100G Octyl-β-D-thioglucopyranoside; Appearance White to off-white solid 100 g
S-9022-0LW Vial, 2 ml., White Glass, w_Writing Surface, w_Perforated White Plastic Screwcap 1000 pcs
1782-1G Octyl-β-D-thioglucopyranoside; Appearance White to off-white solid 1 g


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur