Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protein-tyrosine-phosphatase IBR5 (EC 3.1.3.48) (Protein INDOLE-3-BUTYRIC ACID RESPONSE 5) (Protein IBA RESPONSE 5) (SKP1-interacting partner 33)

 IBR5_ARATH              Reviewed;         257 AA.
Q84JU4; Q3EC68; Q9SJB6;
26-MAY-2009, integrated into UniProtKB/Swiss-Prot.
01-JUN-2003, sequence version 1.
23-MAY-2018, entry version 112.
RecName: Full=Protein-tyrosine-phosphatase IBR5;
EC=3.1.3.48;
AltName: Full=Protein INDOLE-3-BUTYRIC ACID RESPONSE 5;
Short=Protein IBA RESPONSE 5;
AltName: Full=SKP1-interacting partner 33;
Name=IBR5; Synonyms=SKIP33; OrderedLocusNames=At2g04550;
ORFNames=T1O3.4;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, DISRUPTION
PHENOTYPE, TISSUE SPECIFICITY, AND DEVELOPMENTAL STAGE.
STRAIN=cv. Landsberg erecta;
PubMed=14630970; DOI=10.1105/tpc.017046;
Monroe-Augustus M., Zolman B.K., Bartel B.;
"IBR5, a dual-specificity phosphatase-like protein modulating auxin
and abscisic acid responsiveness in Arabidopsis.";
Plant Cell 15:2979-2991(2003).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617197; DOI=10.1038/45471;
Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D.,
Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V.,
Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L.,
Moffat K.S., Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L.,
Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H.,
Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D.,
Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M.,
Venter J.C.;
"Sequence and analysis of chromosome 2 of the plant Arabidopsis
thaliana.";
Nature 402:761-768(1999).
[3]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[5]
INTERACTION WITH SKP1A/ASK1.
PubMed=12795696; DOI=10.1046/j.1365-313X.2003.01768.x;
Risseeuw E.P., Daskalchuk T.E., Banks T.W., Liu E., Cotelesage J.,
Hellmann H., Estelle M., Somers D.E., Crosby W.L.;
"Protein interaction analysis of SCF ubiquitin E3 ligase subunits from
Arabidopsis.";
Plant J. 34:753-767(2003).
[6]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=18423007; DOI=10.1186/1471-2229-8-41;
Strader L.C., Monroe-Augustus M., Bartel B.;
"The IBR5 phosphatase promotes Arabidopsis auxin responses through a
novel mechanism distinct from TIR1-mediated repressor degradation.";
BMC Plant Biol. 8:41-41(2008).
[7]
FUNCTION.
PubMed=18832358; DOI=10.1534/genetics.108.091512;
Strader L.C., Monroe-Augustus M., Rogers K.C., Lin G.L., Bartel B.;
"Arabidopsis iba response5 suppressors separate responses to various
hormones.";
Genetics 180:2019-2031(2008).
[8]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH MPK12.
PubMed=19000167; DOI=10.1111/j.1365-313X.2008.03741.x;
Lee J.S., Wang S., Sritubtim S., Chen J.-G., Ellis B.E.;
"Arabidopsis mitogen-activated protein kinase MPK12 interacts with the
MAPK phosphatase IBR5 and regulates auxin signaling.";
Plant J. 57:975-985(2009).
-!- FUNCTION: Required for the transduction of auxin and abscisic acid
(ABA) signaling pathways. Dephosphorylates and inactivates the MAP
kinase MPK12. {ECO:0000269|PubMed:14630970,
ECO:0000269|PubMed:18423007, ECO:0000269|PubMed:18832358,
ECO:0000269|PubMed:19000167}.
-!- CATALYTIC ACTIVITY: Protein tyrosine phosphate + H(2)O = protein
tyrosine + phosphate. {ECO:0000255|PROSITE-ProRule:PRU10044}.
-!- SUBUNIT: Interacts with SKP1A/ASK1 and with MPK12.
{ECO:0000269|PubMed:12795696, ECO:0000269|PubMed:19000167}.
-!- INTERACTION:
Q8GYQ5:MPK12; NbExp=8; IntAct=EBI-604555, EBI-2128461;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:19000167}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q84JU4-1; Sequence=Displayed;
Name=2;
IsoId=Q84JU4-2; Sequence=VSP_037361;
Note=Derived from EST data. No experimental confirmation
available.;
-!- TISSUE SPECIFICITY: Expressed in root tips and vasculature,
cotyledons, stems, leaves vasculature and hydathodes, flowers,
siliques, and seeds. {ECO:0000269|PubMed:14630970}.
-!- DEVELOPMENTAL STAGE: During flower development, detected in
sepals, anther filaments, and carpels. During germination, levels
decline slightly two days after imbibition.
{ECO:0000269|PubMed:14630970}.
-!- DISRUPTION PHENOTYPE: Impaired responses to phytohormones such as
indole-3-butyric acid, indole-3-acetic acid (auxin), synthetic
auxins, auxin transport inhibitors, and abscisic acid (ABA).
Plants exhibit long roots and short hypocotyls when grown in the
light, with aberrant vascular patterning, increased leaf
serration, and reduced accumulation of auxin-inducible genes.
{ECO:0000269|PubMed:14630970, ECO:0000269|PubMed:18423007}.
-!- SIMILARITY: Belongs to the protein-tyrosine phosphatase family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAD25825.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; BT004283; AAO42283.1; -; mRNA.
EMBL; AC006951; AAD25825.1; ALT_SEQ; Genomic_DNA.
EMBL; CP002685; AEC05845.1; -; Genomic_DNA.
EMBL; CP002685; AEC05846.1; -; Genomic_DNA.
EMBL; BT005609; AAO64029.1; -; mRNA.
EMBL; AY337455; AAR04550.1; -; mRNA.
PIR; G84458; G84458.
RefSeq; NP_178534.2; NM_126486.6. [Q84JU4-1]
RefSeq; NP_973418.2; NM_201689.3. [Q84JU4-2]
UniGene; At.41296; -.
ProteinModelPortal; Q84JU4; -.
SMR; Q84JU4; -.
BioGrid; 398; 3.
IntAct; Q84JU4; 3.
STRING; 3702.AT2G04550.1; -.
PaxDb; Q84JU4; -.
EnsemblPlants; AT2G04550.1; AT2G04550.1; AT2G04550. [Q84JU4-1]
EnsemblPlants; AT2G04550.3; AT2G04550.3; AT2G04550. [Q84JU4-2]
GeneID; 814997; -.
Gramene; AT2G04550.1; AT2G04550.1; AT2G04550. [Q84JU4-1]
Gramene; AT2G04550.3; AT2G04550.3; AT2G04550. [Q84JU4-2]
KEGG; ath:AT2G04550; -.
Araport; AT2G04550; -.
TAIR; locus:2058344; AT2G04550.
eggNOG; KOG1716; Eukaryota.
eggNOG; COG2453; LUCA.
HOGENOM; HOG000006127; -.
InParanoid; Q84JU4; -.
KO; K04459; -.
OMA; MNINDAP; -.
OrthoDB; EOG09360K7C; -.
PhylomeDB; Q84JU4; -.
Reactome; R-ATH-202670; ERKs are inactivated.
PRO; PR:Q84JU4; -.
Proteomes; UP000006548; Chromosome 2.
ExpressionAtlas; Q84JU4; baseline and differential.
Genevisible; Q84JU4; AT.
GO; GO:0005634; C:nucleus; IDA:TAIR.
GO; GO:0033549; F:MAP kinase phosphatase activity; IDA:TAIR.
GO; GO:0004725; F:protein tyrosine phosphatase activity; IEA:UniProtKB-EC.
GO; GO:0008138; F:protein tyrosine/serine/threonine phosphatase activity; IEA:InterPro.
GO; GO:0009738; P:abscisic acid-activated signaling pathway; IEA:UniProtKB-KW.
GO; GO:0009734; P:auxin-activated signaling pathway; IEA:UniProtKB-KW.
GO; GO:0035556; P:intracellular signal transduction; IC:TAIR.
GO; GO:0043407; P:negative regulation of MAP kinase activity; IMP:TAIR.
GO; GO:0046620; P:regulation of organ growth; IMP:TAIR.
GO; GO:0061388; P:regulation of rate of cell growth; IMP:TAIR.
GO; GO:0009737; P:response to abscisic acid; IMP:TAIR.
GO; GO:0009733; P:response to auxin; IMP:TAIR.
CDD; cd00127; DSPc; 1.
Gene3D; 3.90.190.10; -; 1.
InterPro; IPR000340; Dual-sp_phosphatase_cat-dom.
InterPro; IPR024950; DUSP.
InterPro; IPR029021; Prot-tyrosine_phosphatase-like.
InterPro; IPR016130; Tyr_Pase_AS.
InterPro; IPR000387; TYR_PHOSPHATASE_dom.
InterPro; IPR020422; TYR_PHOSPHATASE_DUAL_dom.
PANTHER; PTHR10159; PTHR10159; 1.
Pfam; PF00782; DSPc; 1.
SMART; SM00195; DSPc; 1.
SUPFAM; SSF52799; SSF52799; 1.
PROSITE; PS00383; TYR_PHOSPHATASE_1; 1.
PROSITE; PS50056; TYR_PHOSPHATASE_2; 1.
PROSITE; PS50054; TYR_PHOSPHATASE_DUAL; 1.
1: Evidence at protein level;
Abscisic acid signaling pathway; Alternative splicing;
Auxin signaling pathway; Complete proteome; Hydrolase; Nucleus;
Reference proteome.
CHAIN 1 257 Protein-tyrosine-phosphatase IBR5.
/FTId=PRO_0000375243.
DOMAIN 50 234 Tyrosine-protein phosphatase.
ACT_SITE 129 129 Phosphocysteine intermediate.
{ECO:0000255|PROSITE-ProRule:PRU10044}.
VAR_SEQ 171 257 EFYQQLQEFEQGIFGSEMMSAMNINDAPTFGFGFPKIDNQA
QAPVFNNAPTSSIFSSPASSIPPQEFTFGATPPKPTTGGDI
AMDGS -> VLPTTAGV (in isoform 2).
{ECO:0000305}.
/FTId=VSP_037361.
SEQUENCE 257 AA; 28690 MW; 68CFA8A26DC933DF CRC64;
MRKRERENPC SICGHYHKYE EGEVCGVCGH CMPVSSDTVA PQQVHVSAFP SEILPEFLYL
GSYDNASRSE LLKTQGISRV LNTVPMCQNL YRNSFTYHGL DNEKVLQFDD AIKFLDQCEK
DKARVLVHCM SGKSRSPAVV VAYLMKRKGW RLAESHQWVK QRRPSTDISP EFYQQLQEFE
QGIFGSEMMS AMNINDAPTF GFGFPKIDNQ AQAPVFNNAP TSSIFSSPAS SIPPQEFTFG
ATPPKPTTGG DIAMDGS


Related products :

Catalog number Product name Quantity
EIAAB06775 Cenpi,CENP-I,Centromere protein I,Follicle-stimulating hormone primary response protein,FSH primary response protein 1,Fshprh1,Leucine-rich primary response protein 1,Lrpr1,Rat,Rattus norvegicus
29-710 ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein 0.1 mg
EIAAB32049 Macrophage actin-associated tyrosine-phosphorylated protein,Mayp,Mouse,Mus musculus,PEST phosphatase-interacting protein 2,pp37,Proline-serine-threonine phosphatase-interacting protein 2,Pstpip2
EIAAB06776 Cenpi,CENP-I,Centromere protein I,Follicle-stimulating hormone primary response protein,FSH primary response protein 1,Fshprh1,Mouse,Mus musculus
EIAAB06773 CENPI,CENP-I,Centromere protein I,Follicle-stimulating hormone primary response protein,FSH primary response protein 1,FSHPRH1,Homo sapiens,Human,ICEN19,Interphase centromere complex protein 19,Leucin
EIAAB33052 HCP,Hematopoietic cell protein-tyrosine phosphatase,Homo sapiens,Human,Protein-tyrosine phosphatase 1C,Protein-tyrosine phosphatase SHP-1,PTP1C,PTP-1C,PTPN6,SH-PTP1,Tyrosine-protein phosphatase non-re
EIAAB33026 Mouse,Mus musculus,Protein tyrosine phosphatase DPZPTP,Protein tyrosine phosphatase PTP-BL,Protein-tyrosine phosphatase RIP,Ptp14,PTP36,Ptpn13,Tyrosine-protein phosphatase non-receptor type 13
EIAAB06829 Cenpx,CENP-X,Centromere protein X,Faap10,FANCM-interacting histone fold protein 2,Fanconi anemia-associated polypeptide of 10 kDa,Immediate-early-response protein D9,Mhf2,Mouse,Mus musculus,Retinoic a
15-288-21471 Liprin-alpha-1 - Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1; PTPRF-interacting protein alpha-1; LAR-interacting protein 1; LIP.1 Polyclonal 0.05 mg
15-288-21471 Liprin-alpha-1 - Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1; PTPRF-interacting protein alpha-1; LAR-interacting protein 1; LIP.1 Polyclonal 0.1 mg
15-288-21470 Liprin-alpha-1 - Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1; PTPRF-interacting protein alpha-1; LAR-interacting protein 1; LIP.1 Polyclonal 0.05 mg
15-288-21470 Liprin-alpha-1 - Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-1; PTPRF-interacting protein alpha-1; LAR-interacting protein 1; LIP.1 Polyclonal 0.1 mg
EIAAB33117 FMI,Homo sapiens,hPTP-J,Human,Pancreatic carcinoma phosphatase 2,PCP2,PCP-2,Protein-tyrosine phosphatase J,Protein-tyrosine phosphatase pi,Protein-tyrosine phosphatase receptor omicron,PTP pi,PTP-J,PT
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.01 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.001 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.02 mg
10-782-55086 Tyrosine-protein phosphatase non-receptor type 6 - EC 3.1.3.48; Protein-tyrosine phosphatase 1C; PTP-1C; Hematopoietic cell protein-tyrosine phosphatase; SH-PTP1; Protein-tyrosine phosphatase SHP-1 N_ 0.005 mg
PP-SHP1-020 SHP-1, Tyrosine-protein phosphatase non-receptor type 6, EC 3.1.3.48, Protein-tyrosine phosphatase 1C, PTP-1C, Hematopoietic cell protein-tyrosine phosphatase, SH-PTP1, Protein-tyrosine phosphatase SH 20
I008-100GM Plant Growth Regulators,Indole-3-butyric Acid (IBA),Indole-3-butyric Acid Potassium Salt (IBA-K) 100GM
I008-25GM Plant Growth Regulators,Indole-3-butyric Acid (IBA),Indole-3-butyric Acid Potassium Salt (IBA-K) 25GM
I008-500GM Plant Growth Regulators,Indole-3-butyric Acid (IBA),Indole-3-butyric Acid Potassium Salt (IBA-K) 500GM
EIAAB32063 Ca(2+)_calmodulin-dependent protein kinase phosphatase N,CaMKN,Camkn,CaMKP-N,CaMKP-nucleus,Kiaa1072,Mouse,Mus musculus,Partner of PIX 1,Partner of PIXA,Partner of PIX-alpha,Ppm1e,Protein phosphatase 1
EIAAB33022 Homo sapiens,Human,Protein-tyrosine phosphatase 1D,Protein-tyrosine phosphatase 2C,PTP-1D,PTP2C,PTP-2C,PTPN11,Shp2,SHP-2,SHPTP2,SH-PTP2,SH-PTP3,Tyrosine-protein phosphatase non-receptor type 11
EIAAB33050 Homo sapiens,Human,Neural-specific protein-tyrosine phosphatase,PTPN5,STEP,Striatum-enriched protein-tyrosine phosphatase,Tyrosine-protein phosphatase non-receptor type 5
EIAAB33025 FAP-1,Fas-associated protein-tyrosine phosphatase 1,Homo sapiens,hPTPE1,Human,PNP1,Protein-tyrosine phosphatase 1E,Protein-tyrosine phosphatase PTPL1,PTP1E,PTP-BAS,PTP-E1,PTPL1,PTPN13,Tyrosine-protein


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur