Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protocadherin Fat 3 (hFat3) (Cadherin family member 15) (FAT tumor suppressor homolog 3)

 FAT3_HUMAN              Reviewed;        4589 AA.
Q8TDW7; B5MDB0; Q96AU6;
18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
18-MAR-2008, sequence version 2.
20-JUN-2018, entry version 127.
RecName: Full=Protocadherin Fat 3;
Short=hFat3;
AltName: Full=Cadherin family member 15;
AltName: Full=FAT tumor suppressor homolog 3;
Flags: Precursor;
Name=FAT3; Synonyms=CDHF15, KIAA1989;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16554811; DOI=10.1038/nature04632;
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F.,
Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E.,
FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S.,
Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W.,
Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S.,
Sakaki Y.;
"Human chromosome 11 DNA sequence and analysis including novel gene
identification.";
Nature 440:497-500(2006).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1026-4589 (ISOFORM 2).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[3]
NUCLEOTIDE SEQUENCE [MRNA] OF 3493-4589 (ISOFORM 1), AND VARIANT
GLY-3812.
TISSUE=Brain;
PubMed=11811999; DOI=10.1006/bbrc.2002.6338;
Mitsui K., Nakajima D., Ohara O., Nakayama M.;
"Mammalian fat3: a large protein that contains multiple cadherin and
EGF-like motifs.";
Biochem. Biophys. Res. Commun. 290:1260-1266(2002).
[4]
IDENTIFICATION, AND TISSUE SPECIFICITY.
PubMed=16865240;
Katoh Y., Katoh M.;
"Comparative integromics on FAT1, FAT2, FAT3 and FAT4.";
Int. J. Mol. Med. 18:523-528(2006).
-!- FUNCTION: May play a role in the interactions between neurites
derived from specific subsets of neurons during development.
{ECO:0000250}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass type I
membrane protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q8TDW7-1; Sequence=Displayed;
Name=2;
IsoId=Q8TDW7-2; Sequence=VSP_032327, VSP_032328;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q8TDW7-3; Sequence=VSP_040467;
Note=Gene prediction based on similarity to rat ortholog and
partial EST and cDNA data.;
-!- TISSUE SPECIFICITY: Expressed in ES cells, primitive
neuroectoderm, fetal brain, infant brain, adult neural tissues and
prostate. {ECO:0000269|PubMed:16865240}.
-!- SEQUENCE CAUTION:
Sequence=AAH16722.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AP000722; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AP000805; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AP002514; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AP003171; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AP003718; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC016722; AAH16722.1; ALT_INIT; mRNA.
EMBL; AB076400; BAB86868.1; -; mRNA.
RefSeq; NP_001008781.2; NM_001008781.2. [Q8TDW7-3]
RefSeq; XP_016872670.1; XM_017017181.1. [Q8TDW7-1]
RefSeq; XP_016872672.1; XM_017017183.1. [Q8TDW7-3]
UniGene; Hs.98523; -.
ProteinModelPortal; Q8TDW7; -.
SMR; Q8TDW7; -.
BioGrid; 125669; 36.
STRING; 9606.ENSP00000298047; -.
iPTMnet; Q8TDW7; -.
PhosphoSitePlus; Q8TDW7; -.
BioMuta; FAT3; -.
DMDM; 172045818; -.
EPD; Q8TDW7; -.
MaxQB; Q8TDW7; -.
PaxDb; Q8TDW7; -.
PeptideAtlas; Q8TDW7; -.
PRIDE; Q8TDW7; -.
ProteomicsDB; 74356; -.
ProteomicsDB; 74357; -. [Q8TDW7-2]
ProteomicsDB; 74358; -. [Q8TDW7-3]
Ensembl; ENST00000409404; ENSP00000387040; ENSG00000165323. [Q8TDW7-3]
Ensembl; ENST00000634703; ENSP00000489369; ENSG00000282908. [Q8TDW7-3]
GeneID; 120114; -.
KEGG; hsa:120114; -.
UCSC; uc001pdj.5; human. [Q8TDW7-1]
CTD; 120114; -.
DisGeNET; 120114; -.
EuPathDB; HostDB:ENSG00000165323.15; -.
GeneCards; FAT3; -.
HGNC; HGNC:23112; FAT3.
HPA; HPA026878; -.
MIM; 612483; gene.
neXtProt; NX_Q8TDW7; -.
OpenTargets; ENSG00000165323; -.
PharmGKB; PA134962612; -.
eggNOG; KOG1219; Eukaryota.
eggNOG; ENOG410XPEI; LUCA.
GeneTree; ENSGT00760000118805; -.
HOGENOM; HOG000046499; -.
HOVERGEN; HBG005641; -.
InParanoid; Q8TDW7; -.
KO; K16506; -.
OMA; DNGWMVT; -.
OrthoDB; EOG091G00A0; -.
PhylomeDB; Q8TDW7; -.
TreeFam; TF316403; -.
ChiTaRS; FAT3; human.
GenomeRNAi; 120114; -.
PRO; PR:Q8TDW7; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000165323; -.
CleanEx; HS_FAT3; -.
ExpressionAtlas; Q8TDW7; baseline and differential.
Genevisible; Q8TDW7; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IEA:InterPro.
GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
GO; GO:0007156; P:homophilic cell adhesion via plasma membrane adhesion molecules; IEA:InterPro.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
InterPro; IPR002126; Cadherin.
InterPro; IPR015919; Cadherin-like.
InterPro; IPR020894; Cadherin_CS.
InterPro; IPR013320; ConA-like_dom_sf.
InterPro; IPR001881; EGF-like_Ca-bd_dom.
InterPro; IPR013032; EGF-like_CS.
InterPro; IPR000742; EGF-like_dom.
InterPro; IPR000152; EGF-type_Asp/Asn_hydroxyl_site.
InterPro; IPR018097; EGF_Ca-bd_CS.
InterPro; IPR001791; Laminin_G.
Pfam; PF00028; Cadherin; 26.
Pfam; PF02210; Laminin_G_2; 1.
PRINTS; PR00205; CADHERIN.
SMART; SM00112; CA; 32.
SMART; SM00181; EGF; 4.
SMART; SM00179; EGF_CA; 3.
SMART; SM00282; LamG; 1.
SUPFAM; SSF49313; SSF49313; 34.
SUPFAM; SSF49899; SSF49899; 1.
PROSITE; PS00010; ASX_HYDROXYL; 1.
PROSITE; PS00232; CADHERIN_1; 19.
PROSITE; PS50268; CADHERIN_2; 32.
PROSITE; PS00022; EGF_1; 3.
PROSITE; PS01186; EGF_2; 1.
PROSITE; PS50026; EGF_3; 4.
PROSITE; PS01187; EGF_CA; 1.
PROSITE; PS50025; LAM_G_DOMAIN; 1.
2: Evidence at transcript level;
Alternative splicing; Calcium; Cell adhesion; Complete proteome;
Developmental protein; Disulfide bond; EGF-like domain; Glycoprotein;
Membrane; Methylation; Polymorphism; Reference proteome; Repeat;
Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 32 {ECO:0000255}.
CHAIN 33 4589 Protocadherin Fat 3.
/FTId=PRO_0000324634.
TOPO_DOM 33 4154 Extracellular. {ECO:0000255}.
TRANSMEM 4155 4175 Helical. {ECO:0000255}.
TOPO_DOM 4176 4589 Cytoplasmic. {ECO:0000255}.
DOMAIN 44 158 Cadherin 1. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 159 266 Cadherin 2. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 264 375 Cadherin 3. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 377 472 Cadherin 4. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 473 578 Cadherin 5. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 579 681 Cadherin 6. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 727 831 Cadherin 7. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 832 936 Cadherin 8. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 937 1043 Cadherin 9. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1044 1148 Cadherin 10. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1149 1254 Cadherin 11. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1255 1359 Cadherin 12. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1363 1460 Cadherin 13. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1461 1566 Cadherin 14. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1567 1769 Cadherin 15. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1770 1883 Cadherin 16. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1884 1986 Cadherin 17. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1983 2084 Cadherin 18. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2085 2186 Cadherin 19. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2187 2287 Cadherin 20. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2288 2394 Cadherin 21. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2395 2496 Cadherin 22. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2497 2600 Cadherin 23. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2601 2708 Cadherin 24. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2709 2814 Cadherin 25. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2815 2924 Cadherin 26. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2925 3029 Cadherin 27. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3030 3131 Cadherin 28. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3132 3236 Cadherin 29. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3237 3341 Cadherin 30. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3342 3446 Cadherin 31. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3447 3551 Cadherin 32. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3552 3653 Cadherin 33. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 3795 3833 EGF-like 1. {ECO:0000255|PROSITE-
ProRule:PRU00076}.
DOMAIN 3835 4018 Laminin G-like. {ECO:0000255|PROSITE-
ProRule:PRU00122}.
DOMAIN 4021 4058 EGF-like 2. {ECO:0000255|PROSITE-
ProRule:PRU00076}.
DOMAIN 4060 4096 EGF-like 3. {ECO:0000255|PROSITE-
ProRule:PRU00076}.
DOMAIN 4098 4134 EGF-like 4; calcium-binding.
{ECO:0000255|PROSITE-ProRule:PRU00076}.
COMPBIAS 4438 4509 Pro-rich.
MOD_RES 4542 4542 Omega-N-methylarginine.
{ECO:0000250|UniProtKB:Q8BNA6}.
CARBOHYD 49 49 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 342 342 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 482 482 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 563 563 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 668 668 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 800 800 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 880 880 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 899 899 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1007 1007 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1368 1368 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1430 1430 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1752 1752 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1945 1945 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1994 1994 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1997 1997 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2209 2209 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2293 2293 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2332 2332 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2468 2468 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3001 3001 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3202 3202 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3330 3330 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3450 3450 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3619 3619 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3742 3742 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 3927 3927 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 3799 3810 {ECO:0000250}.
DISULFID 3804 3822 {ECO:0000250}.
DISULFID 3824 3832 {ECO:0000250}.
DISULFID 3985 4018 {ECO:0000250}.
DISULFID 4025 4036 {ECO:0000250}.
DISULFID 4030 4046 {ECO:0000250}.
DISULFID 4048 4057 {ECO:0000250}.
DISULFID 4064 4075 {ECO:0000250}.
DISULFID 4069 4084 {ECO:0000250}.
DISULFID 4086 4095 {ECO:0000250}.
DISULFID 4102 4113 {ECO:0000250}.
DISULFID 4107 4122 {ECO:0000250}.
DISULFID 4124 4133 {ECO:0000250}.
VAR_SEQ 1204 1260 LITTTSRKLDREQQAEHFLEVTVTDGGPSPKQSTIWVVVQV
LDENDNKPQFPEKVYQ -> SCSVAQAGMQWHDRSSLQSRT
PGFKGYPCLSLLSSWDYRHAPPCPATFLNS (in
isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_032327.
VAR_SEQ 1261 4589 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_032328.
VAR_SEQ 4351 4382 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_040467.
VARIANT 412 412 S -> F (in dbSNP:rs10830902).
/FTId=VAR_039851.
VARIANT 462 462 I -> V (in dbSNP:rs16917409).
/FTId=VAR_039852.
VARIANT 1167 1167 V -> G (in dbSNP:rs11821058).
/FTId=VAR_039853.
VARIANT 1726 1726 Q -> R (in dbSNP:rs7949157).
/FTId=VAR_039854.
VARIANT 2293 2293 N -> S (in dbSNP:rs16918105).
/FTId=VAR_039855.
VARIANT 2622 2622 V -> F (in dbSNP:rs17615477).
/FTId=VAR_039856.
VARIANT 2755 2755 I -> V (in dbSNP:rs3847531).
/FTId=VAR_039857.
VARIANT 3518 3518 V -> L (in dbSNP:rs10765565).
/FTId=VAR_039858.
VARIANT 3812 3812 S -> G (in dbSNP:rs4753069).
{ECO:0000269|PubMed:11811999}.
/FTId=VAR_039859.
SEQUENCE 4589 AA; 505523 MW; C993CE7F08EC6BF9 CRC64;
MDIIMGHCVG TRPPACCLIL LLFKLLATVS QGLPGTGPLG FHFTHSIYNA TVYENSAART
YVNSQSRMGI TLIDLSWDIK YRIVSGDEEG FFKAEEVIIA DFCFLRIRTK GGNSAILNRE
IQDNYLLIVK GSVRGEDLEA WTKVNIQVLD MNDLRPLFSP TTYSVTIAES TPLRTSVAQV
TATDADIGSN GEFYYYFKNK VDLFSVHPTS GVISLSGRLN YDEKNRYDLE ILAVDRGMKL
YGNNGVSSTA KLYVHIERIN EHAPTIHVVT HVPFSLEKEP TYAVVTVDDL DDGANGEIES
VSIVAGDPLD QFFLAKEGKW LNEYKIKERK QIDWESFPYG YNLTLQAKDK GSPQKCSALK
AVYIGNPTRD TVPIRFEKEV YDVSISEFSP PGVVVAIVKL SPEPIDVEYK LSPGEDAVYF
KINPRSGLIV TARPLNTVKK EVYKLEVTNK EGDLKAQVTI SIEDANDHTP EFQQPLYDAY
VNESVPVGTS VLTVSASDKD KGENGYITYS IASLNLLPFV INQFTGVIST TEELDFESSP
EIYRFIVRAS DWGSPYRHES EVNVTIRIGN VNDNSPLFEK VACQGVISYD FPVGGHITAV
SAIDIDELEL VKYKIISGNE LGFFYLNPDS GVLQLKKSLT NSGIKNGNFA LRITATDGEN
LADPMSINIS VLHGKVSSKS FSCRETRVAQ KLAEKLLIKA KANGKLNLED GFLDFYSINR
QGPYFDKSFP SDVAVKEDLP VGANILKIKA YDADSGFNGK VLFTISDGNT DSCFNIDMET
GQLKVLMPMD REHTDLYLLN ITIYDLGNPQ KSSWRLLTIN VEDANDNSPV FIQDSYSVNI
LESSGIGTEI IQVEARDKDL GSNGEVTYSV LTDTQQFAIN SSTGIVYVAD QLDRESKANY
SLKIEARDKA ESGQQLFSVV TLKVFLDDVN DCSPAFIPSS YSVKVLEDLP VGTVIAWLET
HDPDLGLGGQ VRYSLVNDYN GRFEIDKASG AIRLSKELDY EKQQFYNLTV RAKDKGRPVS
LSSVSFVEVE VVDVNENLHT PYFPDFAVVG SVKENSRIGT SVLQVTARDE DSGRDGEIQY
SIRDGSGLGR FSIDDESGVI TAADILDRET MGSYWLTVYA TDRGVVPLYS TIEVYIEVED
VNDNAPLTSE PIYYPVVMEN SPKDVSVIQI QAEDPDSSSN EKLTYRITSG NPQNFFAINI
KTGLITTTSR KLDREQQAEH FLEVTVTDGG PSPKQSTIWV VVQVLDENDN KPQFPEKVYQ
IKLPERDRKK RGEPIYRAFA FDRDEGPNAE ISYSIVDGND DGKFFIDPKT GMVSSRKQFT
AGSYDILTIK AVDNGRPQKS STARLHIEWI KKPPPSPIPL TFDEPFYNFT VMESDRVTEI
VGVVSVQPAN TPLWFDIVGG NFDSAFDAEK GVGTIVIAKP LDAEQRSIYN MSVEVTDGTN
VAVTQVFIKV LDNNDNGPEF SQPNYDVTIS EDVLPDTEIL QIEATDRDEK HKLSYTVHSS
IDSISMRKFR IDPSTGVLYT AERLDHEAQD KHILNIMVRD QEFPYRRNLA RVIVNVEDAN
DHSPYFTNPL YEASVFESAA LGSAVLQVTA LDKDKGENAE LIYTIEAGNT GNMFKIEPVL
GIITICKEPD MTTMGQFVLS IKVTDQGSPP MSATAIVRIS VTMSDNSHPK FIHKDYQAEV
NENVDIGTSV ILISAISQST LIYEVKDGDI NGIFTINPYS GVITTQKALD YERTSSYQLI
IQATNMAGMA SNATVNIQIV DENDNAPVFL FSQYSGSLSE AAPINSIVRS LDNSPLVIRA
TDADSNRNAL LVYQIVESTA KKFFTVDSST GAIRTIANLD HETIAHFHFH VHVRDSGSPQ
LTAESPVEVN IEVTDVNDNP PVFTQAVFET ILLLPTYVGV EVLKVSATDP DSEVPPELTY
SLMEGSLDHF LIDSNSGVLT IKNNNLSKDH YMLIVKVSDG KFYSTSMVTI MVKEAMDSGL
HFTQSFYSTS ISENNTNITK VAIVNAVGNR LNEPLKYSIL NPGNKFKIKS TSGVIQTTGV
PFDREEQELY ELVVEASREL DHLRVARVVV RVNIEDINDN SPVFVGLPYY AAVQVDAEPG
TLIYQVTAID KDKGPNGEVT YVLQDDYGHF EINPNSGNVI LKEAFNSDLS NIEYGVTILA
KDGGKPSLST SVELPITIVN KAMPVFDKPF YTASVNEDIR MNTPILSINA TSPEGQGIIY
IIIDGDPFKQ FNIDFDTGVL KVVSPLDYEV TSAYKLTIRA SDALTGARAE VTVDLLVNDV
NDNPPIFDQP TYNTTLSEAS LIGTPVLQVV SIDADSENNK MVHYQIVQDT YNSTDYFHID
SSSGLILTAR MLDHELVQHC TLKVRSIDSG FPSLSSEVLV HIYISDVNDN PPVFNQLIYE
SYVSELAPRG HFVTCVQASD ADSSDFDRLE YSILSGNDRT SFLMDSKSGV ITLSNHRKQR
MEPLYSLNVS VSDGLFTSTA QVHIRVLGAN LYSPAFSQST YVAEVRENVA AGTKVIHVRA
TDGDPGTYGQ ISYAIINDFA KDRFLIDSNG QVITTERLDR ENPLEGDVSI FVRALDGGGR
TTFCTVRVIV VDENDNAPQF MTVEYRASVR ADVGRGHLVT QVQAIDPDDG ANSRITYSLY
SEASVSVADL LEIDPDNGWM VTKGNFNQLK NTVLSFFVKA VDGGIPVKHS LIPVYIHVLP
PETFLPSFTQ SQYSFTIAED TAIGSTVDTL RILPSQNVWF STVNGERPEN NKGGIFVIEQ
ETGTIKLDKR LDRETSPAFH FKVAATIPLD KVDIVFTVDV DIKVLDLNDN KPVFETSSYD
TIIMEGMPVG TKLTQVRAID MDWGANGQVT YSLHSDSQPE KVMEAFNIDS NTGWISTLKD
LDHETDPTFT FSVVASDLGE AFSLSSTALV SVRVTDINDN APVFAQEVYR GNVKESDPPG
EVVAVLSTWD RDTSDVNRQV SYHITGGNPR GRFALGLVQS EWKVYVKRPL DREEQDIYFL
NITATDGLFV TQAMVEVSVS DVNDNSPVCD QVAYTALLPE DIPSNKIILK VSAKDADIGS
NGYIRYSLYG SGNSEFFLDP ESGELKTLAL LDRERIPVYS LMAKATDGGG RFCQSNIHLI
LEDVNDNPPV FSSDHYNTCV YENTATKALL TRVQAVDPDI GINRKVVYSL ADSAGGVFSI
DSSSGIIILE QPLDREQQSS YNISVRATDQ SPGQSLSSLT TVTITVLDIN DNPPVFERRD
YLVTVPEDTS PGTQVLAVFA TSKDIGTNAE ITYLIRSGNE QGKFKINPKT GGISVSEVLD
YELCKRFYLV VEAKDGGTPA LSAVATVNIN LTDVNDNPPK FSQDVYSAVI SEDALVGDSV
ILLIAEDVDS QPNGQIHFSI VNGDRDNEFT VDPVLGLVKV KKKLDRERVS GYSLLVQAVD
SGIPAMSSTA TVNIDISDVN DNSPVFTPAN YTAVIQENKP VGTSILQLVV TDRDSFHNGP
PFSFSILSGN EEEEFVLDPH GILRSAVVFQ HTESLEYVLC VQAKDSGKPQ QVSHTYIRVR
VIEESTHKPT AIPLEIFIVT MEDDFPGGVI GKIHATDQDM YDVLTFALKS EQKSLFKVNS
HDGKIIALGG LDSGKYVLNV SVSDGRFQVP IDVVVHVEQL VHEMLQNTVT IRFENVSPED
FVGLHMHGFR RTLRNAVLTQ KQDSLRIISI QPVAGTNQLD MLFAVEMHSS EFYKPAYLIQ
KLSNARRHLE NIMRISAILE KNCSGLDCQE QHCEQGLSLD SHALMTYSTA RISFVCPRFY
RNVRCTCNGG LCPGSNDPCV EKPCPGDMQC VSYEASRRPF LCQCPPGKLG ECSGHTSLSF
AGNSYIKYRL SENSKEEDFK LALRLRTLQS NGIIMYTRAN PCIILKIVDG KLWFQLDCGS
GPGILGISGR AVNDGSWHSV FLELNRNFTS LSLDDSYVER RRAPLYFQTL STESSIYFGA
LVQADNIRSL TDTRVTQVLS GFQGCLDSVI LNNNELPLQN KRSSFAEVVG LTELKLGCVL
YPDACKRSPC QHGGSCTGLP SGGYQCTCLS QFTGRNCESE ITACFPNPCR NGGSCDPIGN
TFICNCKAGL TGVTCEEDIN ECEREECENG GSCVNVFGSF LCNCTPGYVG QYCGLRPVVV
PNIQAGHSYV GKEELIGIAV VLFVIFILVV LFIVFRKKVF RKNYSRNNIT LVQDPATAAL
LNKSNGIPFR NLRGSGDGRN VYQEVGPPQV PVRPMAYTPC FQSDSRSNLD KIVDGLGGEH
QEMTTFHPES PRILTARRGV VVCSVAPNLP AVSPCRSDCD SIRKNGWDAG TENKGVDDPG
EVTCFAGSNK GSNSEVQSLS SFQSDSGDDN ASIVTVIQLV NNVVDTIENE VSVMDQGQNY
NRAYHWDTSD WMPGARLSDI EEVPNYENQD GGSAHQGSTR ELESDYYLGG YDIDSEYPPP
HEEEFLSQDQ LPPPLPEDFP DQYEALPPSQ PVSLASTLSP DCRRRPQFHP SQYLPPHPFP
NETDLVGPPA SCEFSTFAVS MNQGTEPTGP ADSVSLSLHN SRGTSSSDVS ANCGFDDSEV
AMSDYESVGE LSLASLHIPF VETQHQTQV


Related products :

Catalog number Product name Quantity
EIAAB14456 Cadherin family member 15,CDHF15,FAT tumor suppressor homolog 3,FAT3,hFat3,Homo sapiens,Human,KIAA1989,Protocadherin Fat 3
EIAAB14451 Cadherin family member 7,Cadherin-related tumor suppressor homolog,CDHF7,FAT,FAT1,Homo sapiens,Human,Protein fat homolog,Protocadherin Fat 1
EIAAB14459 Cadherin family member 14,CDHF14,FAT tumor suppressor homolog 4,FAT4,FATJ,Fat-like cadherin protein FAT-J,hFat4,Homo sapiens,Human,Nbla00548,Protocadherin Fat 4
EIAAB14458 FAT tumor suppressor homolog 4,Fat4,Fatj,Fat-like cadherin protein FAT-J,Mouse,Mus musculus,Protocadherin Fat 4
EIAAB06480 Cadherin-related family member 1,Cdhr1,Kiaa1775,MT-protocadherin,Pcdh21,Photoreceptor cadherin,prCAD,Prcad,Protocadherin-21,Rat,Rattus norvegicus
EIAAB06485 Cadherin-related family member 2,CDHR2,Homo sapiens,Human,PCDH24,PCLKC,PC-LKC,Protocadherin LKC,Protocadherin-24
EIAAB06490 Cadherin-related family member 5,Cdhr5,Mouse,Mucdhl,Mucin and cadherin-like protein,Mupcdh,Mu-protocadherin,Mus musculus
BPA1053 FAT tumor suppressor homolog 4 Protocadherin Fat 4 Polyclonal Antibodie 100 μg
BPA1053 FAT tumor suppressor homolog 4 _ Protocadherin Fat 4 Polyclonal Antibodie 100 μg
EIAAB06491 Cadherin-related family member 5,Cdhr5,GP100,Mucdhl,Mucin and cadherin-like protein,Mupcdh,Mu-protocadherin,Rat,Rattus norvegicus
EIAAB06489 Cadherin-related family member 5,CDHR5,Homo sapiens,Human,MUCDHL,Mucin and cadherin-like protein,MUPCDH,Mu-protocadherin,UNQ2781_PRO7168
BPA1053 FAT tumor suppressor homolog 4 _ Protocadherin Fat 4, Polyclonal primary Antibodies 100 μg
EIAAB14457 FAT tumor suppressor homolog 3,Fat3,Protocadherin Fat 3,Rat,Rattus norvegicus
'BPA1053 FAT tumor suppressor homolog 4 Protocadherin Fat 4 IgG antibody Ab host: Rabbit 0.1 mg
EIAAB14455 FAT tumor suppressor homolog 3,Fat3,Gm1132,Gm510,Mouse,Mus musculus,Protocadherin Fat 3
EIAAB14454 FAT tumor suppressor homolog 2,Fat2,Fath2,Kiaa0811,Mouse,Mus musculus,Protocadherin Fat 2
EIAAB06482 Bos taurus,Bovine,Cadherin-related family member 1,CDHR1,PCDH21,Photoreceptor cadherin,prCAD,PRCAD,Protocadherin-21
EIAAB06483 Cadherin-related family member 1,Cdhr1,Kiaa1775,Mouse,Mus musculus,Pcdh21,Photoreceptor cadherin,prCAD,Prcad,Protocadherin-21
EIAAB06484 Cadherin-related family member 1,CDHR1,Homo sapiens,Human,KIAA1775,PCDH21,Photoreceptor cadherin,prCAD,PRCAD,Protocadherin-21
EIAAB25787 Angiotensin-II type 2 receptor-interacting protein,Atip,Microtubule-associated tumor suppressor 1 homolog,Mitochondrial tumor suppressor 1 homolog,Mtsg1,Mtus1,Rat,Rattus norvegicus
EIAAB25785 Bos taurus,Bovine,Microtubule-associated tumor suppressor 1 homolog,Mitochondrial tumor suppressor 1 homolog,MTUS1
EIAAB06481 Cadherin-related family member 1,CDHR1,Chicken,Gallus gallus,PCDH21,Photoreceptor cadherin,prCAD,PRCAD,Protocadherin-21
EIAAB30062 Cadherin-27,Cadherin-like protein CDHJ,Cadherin-like protein VR8,CDH27,CDHJ,DCHS2,Homo sapiens,Human,PCDH23,PCDHJ,Protein dachsous homolog 2,Protocadherin PCDHJ,Protocadherin-23
EIAAB30053 Cadherin-19,Cadherin-25,CDH19,CDH25,DCHS1,FIB1,Fibroblast cadherin-1,Homo sapiens,Human,KIAA1773,PCDH16,Protein dachsous homolog 1,Protocadherin-16
EIAAB06746 Cadherin EGF LAG seven-pass G-type receptor 1,Cadherin family member 9,CDHF9,CELSR1,Flamingo homolog 2,FMI2,hFmi2,Homo sapiens,Human


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur