Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Protocadherin-23 (Cadherin-27) (Cadherin-like protein CDHJ) (Cadherin-like protein VR8) (Protein dachsous homolog 2) (Protocadherin PCDHJ)

 PCD23_HUMAN             Reviewed;        2916 AA.
Q6V1P9; B2RU14; E9PC11; Q4W5P9; Q6ZS61; Q9NXU8;
01-JUL-2008, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
28-FEB-2018, entry version 121.
RecName: Full=Protocadherin-23;
AltName: Full=Cadherin-27;
AltName: Full=Cadherin-like protein CDHJ;
AltName: Full=Cadherin-like protein VR8;
AltName: Full=Protein dachsous homolog 2;
AltName: Full=Protocadherin PCDHJ;
Name=DCHS2; Synonyms=CDH27, CDHJ, PCDH23, PCDHJ;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
PubMed=15003449; DOI=10.1016/j.jmb.2004.01.026;
Hoeng J.C., Ivanov N.V., Hodor P., Xia M., Wei N., Blevins R.,
Gerhold D., Borodovsky M., Liu Y.;
"Identification of new human cadherin genes using a combination of
protein motif search and gene finding methods.";
J. Mol. Biol. 337:307-317(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), NUCLEOTIDE
SEQUENCE [LARGE SCALE MRNA] OF 1902-2916 (ISOFORM 1), AND VARIANT
LEU-344.
TISSUE=Colon;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), AND VARIANTS
ARG-174 AND LEU-344.
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Calcium-dependent cell-adhesion protein. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane
protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Comment=Additional isoforms seem to exist.;
Name=1;
IsoId=Q6V1P9-1; Sequence=Displayed;
Name=4;
IsoId=Q6V1P9-4; Sequence=VSP_034586, VSP_034587, VSP_034588,
VSP_034589, VSP_046654, VSP_046655;
Note=Ref.2 (BAC87093) sequence differs from that shown due to a
frameshift in position 1364. Ref.2 (BAC87093) sequence is in
conflict in position: 446:C->G. Ref.2 (BAC87093) sequence is in
conflict in position: 1358:K->KQ. {ECO:0000305};
-!- TISSUE SPECIFICITY: Cerebral cortex and testis.
{ECO:0000269|PubMed:15003449}.
-!- SEQUENCE CAUTION:
Sequence=AAY41019.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Sequence=BAA90911.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY354497; AAR10443.1; -; mRNA.
EMBL; AK000054; BAA90911.1; ALT_INIT; mRNA.
EMBL; AK127704; BAC87093.1; ALT_FRAME; mRNA.
EMBL; AC079298; AAY41019.1; ALT_SEQ; Genomic_DNA.
EMBL; AC110608; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC110775; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC140919; AAI40920.1; -; mRNA.
RefSeq; NP_001136024.1; NM_001142552.1.
RefSeq; NP_060109.2; NM_017639.3. [Q6V1P9-1]
UniGene; Hs.655664; -.
ProteinModelPortal; Q6V1P9; -.
SMR; Q6V1P9; -.
BioGrid; 120157; 1.
STRING; 9606.ENSP00000349768; -.
iPTMnet; Q6V1P9; -.
PhosphoSitePlus; Q6V1P9; -.
BioMuta; DCHS2; -.
DMDM; 74762378; -.
PaxDb; Q6V1P9; -.
PeptideAtlas; Q6V1P9; -.
PRIDE; Q6V1P9; -.
Ensembl; ENST00000623607; ENSP00000485514; ENSG00000197410. [Q6V1P9-1]
Ensembl; ENST00000638949; ENSP00000491296; ENSG00000284227. [Q6V1P9-1]
GeneID; 54798; -.
KEGG; hsa:54798; -.
UCSC; uc003inw.2; human. [Q6V1P9-1]
CTD; 54798; -.
DisGeNET; 54798; -.
EuPathDB; HostDB:ENSG00000197410.12; -.
GeneCards; DCHS2; -.
H-InvDB; HIX0004584; -.
HGNC; HGNC:23111; DCHS2.
HPA; HPA064159; -.
MIM; 612486; gene.
neXtProt; NX_Q6V1P9; -.
OpenTargets; ENSG00000197410; -.
PharmGKB; PA134953793; -.
eggNOG; KOG1219; Eukaryota.
eggNOG; KOG3594; Eukaryota.
eggNOG; ENOG410XPEI; LUCA.
GeneTree; ENSGT00760000118805; -.
HOGENOM; HOG000115466; -.
HOVERGEN; HBG053522; -.
InParanoid; Q6V1P9; -.
KO; K16507; -.
OMA; HYLFRVV; -.
OrthoDB; EOG091G0023; -.
PhylomeDB; Q6V1P9; -.
TreeFam; TF330641; -.
GeneWiki; DCHS2; -.
GenomeRNAi; 54798; -.
PRO; PR:Q6V1P9; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000197410; -.
CleanEx; HS_DCHS2; -.
ExpressionAtlas; Q6V1P9; baseline and differential.
Genevisible; Q6V1P9; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IEA:InterPro.
GO; GO:0005509; F:calcium ion binding; IEA:InterPro.
GO; GO:0072137; P:condensed mesenchymal cell proliferation; IEA:Ensembl.
GO; GO:0007156; P:homophilic cell adhesion via plasma membrane adhesion molecules; IEA:InterPro.
GO; GO:0072006; P:nephron development; IEA:Ensembl.
InterPro; IPR002126; Cadherin.
InterPro; IPR015919; Cadherin-like.
InterPro; IPR020894; Cadherin_CS.
Pfam; PF00028; Cadherin; 19.
PRINTS; PR00205; CADHERIN.
SMART; SM00112; CA; 21.
SUPFAM; SSF49313; SSF49313; 23.
PROSITE; PS00232; CADHERIN_1; 13.
PROSITE; PS50268; CADHERIN_2; 22.
2: Evidence at transcript level;
Alternative splicing; Calcium; Cell adhesion; Complete proteome;
Glycoprotein; Membrane; Polymorphism; Reference proteome; Repeat;
Transmembrane; Transmembrane helix.
CHAIN 1 2916 Protocadherin-23.
/FTId=PRO_0000343410.
TRANSMEM 2541 2561 Helical. {ECO:0000255}.
DOMAIN 56 177 Cadherin 1. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 178 382 Cadherin 2. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 378 480 Cadherin 3. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 481 583 Cadherin 4. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 586 692 Cadherin 5. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 693 839 Cadherin 6. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 844 960 Cadherin 7. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 949 1055 Cadherin 8. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1056 1165 Cadherin 9. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1165 1269 Cadherin 10. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1270 1374 Cadherin 11. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1375 1478 Cadherin 12. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1479 1583 Cadherin 13. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1584 1685 Cadherin 14. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1685 1787 Cadherin 15. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1788 1892 Cadherin 16. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1892 1992 Cadherin 17. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 1993 2094 Cadherin 18. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2095 2210 Cadherin 19. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2211 2314 Cadherin 20. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2315 2425 Cadherin 21. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
DOMAIN 2426 2533 Cadherin 22. {ECO:0000255|PROSITE-
ProRule:PRU00043}.
CARBOHYD 220 220 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 245 245 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 406 406 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 467 467 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 539 539 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 673 673 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 820 820 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1032 1032 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1140 1140 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1209 1209 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1443 1443 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1599 1599 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1615 1615 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 1874 1874 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2024 2024 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2042 2042 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2100 2100 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2209 2209 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2474 2474 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2522 2522 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 2635 2635 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 78 MRLDEITKSENEDGEKKMFTQQFESTDACVYEVYVKINSIV
KSQSQCGLKRGSPETELWGAIVFRSQEENAKPVKETE ->
MSPCGRKMGEGRQQQRAPVGKLLLLPGRRDTPHGRSGSSGA
RTQRSLLWLLVHVWLWAASGSSAQLFNLTLSVDEGLPPDTL
VGDIRAGLPAAQQQEGSGFFLSEDSDDSPLLDDFHVHPDTG
IIRTARRLDRERRDHYSFVAATLLGAVVQVEIRVNDVNDHS
PRFPLDSLQLDVSELSPPGTAFRLPGAHDPDAGLFSTQGYT
LVQPSDLPKDPAGPFFQLRYRTPGPLPSPLLPGSSSPLEPL
DLVLLRRLDREEAAAHRLQIEAWDGGRPRRTGLLSVELRVL
DENDNPPVFEQDEYRAAVREDAQPGAEVCRVRATDRDLGPN
GFVRYSVRARQVPGAGSGGGALGDAAYFAVEELSGVVRVWR
PLDREAQAWHQLVVEARDGGAEPEVATVRVSIAVLDVNDNR
PAIHVLFLTEGGVARVSEGARPGDYVARVSVSDADCDWEKE
DEATGELGVGLGDGSISLSLEGGEGDFALLPGGPPGVFFLC
VEGPLDRESRDLYELLLVATDAGSPPLSTEETLLLRVADLN
DQPPLFSQQHYKASVSEAAAPGTVVMWVSASDADEAGSDHA
WLRYTVVQLSAPCNLGSLESKMVHTAECGPSFAIDSESGVI
STIRALDREVQEAVELKVVAQDLGEPPLSATCLVSITVDDV
NDNEPIFWRQVYNATIAEHAPVGHCFLQ (in isoform
4). {ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_034586.
VAR_SEQ 143 154 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_034587.
VAR_SEQ 232 326 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_034588.
VAR_SEQ 745 788 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_034589.
VAR_SEQ 885 914 EDSSDHFKIDANNGEIRTTTILSYDYRPSY -> ARHMPLK
GKTAFGKQSCKKTNKQTNKILT (in isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_046654.
VAR_SEQ 915 2916 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_046655.
VARIANT 153 153 V -> A (in dbSNP:rs11721758).
/FTId=VAR_044362.
VARIANT 174 174 H -> R (in dbSNP:rs10017772).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_044363.
VARIANT 344 344 S -> L (in dbSNP:rs6858712).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334}.
/FTId=VAR_044364.
VARIANT 827 827 V -> I (in dbSNP:rs7666283).
/FTId=VAR_044365.
VARIANT 897 897 N -> S (in dbSNP:rs1352714).
/FTId=VAR_044366.
VARIANT 1205 1205 S -> L (in dbSNP:rs11935573).
/FTId=VAR_044367.
VARIANT 1480 1480 T -> R (in dbSNP:rs17031394).
/FTId=VAR_044368.
VARIANT 1595 1595 E -> Q (in dbSNP:rs28561984).
/FTId=VAR_061075.
VARIANT 2112 2112 T -> M (in dbSNP:rs17031279).
/FTId=VAR_044369.
VARIANT 2303 2303 S -> N (in dbSNP:rs6824133).
/FTId=VAR_044370.
CONFLICT 2061 2061 Q -> R (in Ref. 2; BAA90911).
{ECO:0000305}.
CONFLICT 2074 2074 L -> P (in Ref. 2; BAA90911).
{ECO:0000305}.
CONFLICT 2475 2475 K -> R (in Ref. 2; BAA90911).
{ECO:0000305}.
CONFLICT 2633 2633 H -> Y (in Ref. 2; BAA90911).
{ECO:0000305}.
SEQUENCE 2916 AA; 322234 MW; 25B2F4496468ABB5 CRC64;
MRLDEITKSE NEDGEKKMFT QQFESTDACV YEVYVKINSI VKSQSQCGLK RGSPETELWG
AIVFRSQEEN AKPVKETEVT ASDADSGLYG FIEYSLYDGF LSYEAPQAFR IDPHDGQICV
SQDIDRERDP ATYDLLVEAK DGDEQRMTHL ALVKGGLSAQ AFVRVDLEDV NDNHPVFNPS
TYVTSISDET QPGTEIINVL ATDQDSGIYG TVAYELIPGN VSSLFTIDST TGLYSPEVEI
LSAVNFSADK EVMNSLEMFL PLLRHFKKVE RDEEAAEKKF EASRGWFMRF KGRRHLHYLK
VQDEAASADG EAAARYVANL AKILGEGIIY LTLPLSHLES TTLSLMVSAQ DGGGLTAVIN
ADVTIHIFQT TLAPAEFERP KYTFLVYEDV PEDSPIGTVK AREPLNSSEP IFYRISSGDL
GGKFSIHPRL GTIRTRKPLD HETQPVVVLT VQAQLGSAPA CSSTEVNITV MDVNDNHPAF
LRTSDEIRIS QTTPPGTALY LARAEDRDSG RNGLIRYSIA SPQPGVFAID RALGVLFLNG
SLGAGEQREL TLTLRAEDQG VHPQAALLVL TVVIEKREHS PSWTFEHLVY QVEVSESLSP
MTQMLQTQAH PLGPQRAASP LRYSLEPSVD SAMFGIRPYT GWIYLRRQFD YESTQTYNFR
VFAWIPEDGF LQNVSTTVIV RVWDENDNSP TFLHDVLFLK VEESPVPQGV IGKITAIDMD
SGKNGQLLYF LLSDGKFFKM NPNTGPAGTI YVITWADGAA AFSGTDFAFS SDELQAFVLK
SLFCELGEGE LINWVALDRE HRGHHEMTVL VTDRGSPPRN ATMAVYVSVT DINDNRPFFP
QCLPGKELHV KVLEGQPVNM LVTTVFAKDP DEGNNAEVTY SVSSEDSSDH FKIDANNGEI
RTTTILSYDY RPSYRMSVIA TDQGVPPLQG QAVVNIQVIP LSKGRAIMSQ NIRHLIIPEN
LKPTKIMSLI KSSDHLQQHY NGKLHFSIVA DDKDGHFEID SSTGDLFLSK ELDYETTSHY
LFRVITTDHS KNLSLSSTVF LSIDVEDQND HSPSFQDELI VISVEENVPI GTLVYVFNAK
DDDGSFLNSR IQYYIESHNP GTNPFLIHPS FGTLVTVSRL DRESIPTVIL TVTASDQAVN
VTDRRLRSLT AQIVILDVND HNPTFISFPN AHVKEDVTVG SLVHHITAHD PDEGRNGKVT
YSILSGNENM TFMLDESSGL LTTTCPLDYE MKTQHILTVL ALDDGTPALS SSQTLTVTVL
DVNDEAPVFK QHLYEASVKE NQNPGEFVTR VEALDRDSGV NSKLQFEIMP GASFELFEIN
SDTGEVVTTT ILDREIQEVF TLRVLVRDGG FPSLSSTTTI LCTVEDENDH APEFIVSSYD
IEVLENQEPE VVYTVLASDM DAGNNRAVEY HIIDGNTDEC FTINEMSGEL STTRALDREQ
ISNFTLVILC SDLGDPPRSS VIHLQVRVLD ANDHSPSFPT LYYQSSVRED AEVGTVVLVL
SAVDKDEGLN GQTEYFLTDE ASGAFTIDPM SGTLKTSNTL DREARSQHTF SAVARDCSIQ
GSRSTTVIIK VYVTDVNDND PVLEQNPFDV FLSPESPTNQ TTVIVRADDL DLGPNGTVVF
SFAETQSMFS IDKYTGEIQF QQNPSSEYFP IWLQLKVTDQ GIPARTTTGL LVIHMEGEDV
KISFSHHLYK GLVTENCEAG TSIVTVKAFA PDSIQDSMKY SIFSGNEDGV LSLCSKSGQL
TVKEPKFLDF EVRNEVQLIV LAESSGHRAY CKVAVLIQDE NDNSPCFEQS IYQASVSESQ
LYNAHVIQVF ATDLDSGLNG LIEYSILSGN QEEAFQIDAL SGVITTKAIL DYELTSSYSL
IVQATDKGMP RLSNTTVIKV QVTDINDNAP AFLPSEAVEI TEDSLPGVIV THVSVHDVDL
NSAFIFSFAK ESNPGTKFAI DQNTGVVVLV KTLDFEEMTE YELLIQISDS VHYTEGALVV
RVLDVNDNPP VFSQDFYQVT VPESIPVGYS VLTLSATDLE SNENISYRIL SSSKEFSIDP
KNGTIFTISP VLLLDTISTT QFLVEASDGG NPDLRALTLV EIGIEDMNNY APEFTVKSYN
LSLSEDALVG STLVTFSNID HDWTRENTYV EYSIISGNSQ NNFHVETKFF HSEYPYKQVG
YLVLLHSLDR EASASHELVI LASDSGCPPL SSTAVISIQV LDVNDNPPNF SSLSYHTHVK
ESTPLGSHIT VVSANDRDTG SHAEIIYNII SGNEKGHFYL EENTGVLYLI KPLDYEKMTK
FTLTVQASDA EKKHFSFAVV FVSVLDDNDH APQFMFSSFS CIVPENLPIS STICSINALD
FDAGPYGELT YSIVSPCFLT HGMSYDHDLF LIDPLTGDIH AKQILDYENG NKYCLTVQAK
DKGDATASLV VWVDIEGIDE FEPIFTQDQY FFTLPEKNKD RQLIGRVEAS DADAGIDGVI
LYSLGTSSPF FSVNKTNGNI YLIRALPLIK SQLNKEDTLE MKIIAHSPKS DSKFASCTVF
VNVSFSSEGT PLAVFASSFS ISLVVSFLVF LILICILIVM ILRHKQKDTI NNYEEKKTSS
LDADLRVTRD ASVLKAFQKT DDCSNEVVPV DATPEWLSLI SIMEKDIVNL YRHSNSSGHC
SVEGETAEDK EIQRINEHPY RKCSDSALSD HESRVPDSGI PRDSDQLSCL SGETDVMVTA
ETAEASQTFG EGDQGEGCST TCAQNNVLPQ TVQKREAKES ILADVRKESV FISGDQEVRC
AALSTQTTSD HDGKDNYHWN YLLSWEPKFQ PLASVFNDIA KLKDEHLHMP GIPKEKKSFV
FPPPLITAVA QPGIKAVPPR MPAVNLGQVP PKHPRSPIPY HLGSLPEGMT PNFSPSLSLL
TMQPPALSPL LREGELLGTH ISGTCHELKA EDEVQI


Related products :

Catalog number Product name Quantity
EIAAB30062 Cadherin-27,Cadherin-like protein CDHJ,Cadherin-like protein VR8,CDH27,CDHJ,DCHS2,Homo sapiens,Human,PCDH23,PCDHJ,Protein dachsous homolog 2,Protocadherin PCDHJ,Protocadherin-23
EIAAB30053 Cadherin-19,Cadherin-25,CDH19,CDH25,DCHS1,FIB1,Fibroblast cadherin-1,Homo sapiens,Human,KIAA1773,PCDH16,Protein dachsous homolog 1,Protocadherin-16
EIAAB14451 Cadherin family member 7,Cadherin-related tumor suppressor homolog,CDHF7,FAT,FAT1,Homo sapiens,Human,Protein fat homolog,Protocadherin Fat 1
EIAAB14459 Cadherin family member 14,CDHF14,FAT tumor suppressor homolog 4,FAT4,FATJ,Fat-like cadherin protein FAT-J,hFat4,Homo sapiens,Human,Nbla00548,Protocadherin Fat 4
EIAAB06490 Cadherin-related family member 5,Cdhr5,Mouse,Mucdhl,Mucin and cadherin-like protein,Mupcdh,Mu-protocadherin,Mus musculus
EIAAB06491 Cadherin-related family member 5,Cdhr5,GP100,Mucdhl,Mucin and cadherin-like protein,Mupcdh,Mu-protocadherin,Rat,Rattus norvegicus
EIAAB06489 Cadherin-related family member 5,CDHR5,Homo sapiens,Human,MUCDHL,Mucin and cadherin-like protein,MUPCDH,Mu-protocadherin,UNQ2781_PRO7168
EIAAB06480 Cadherin-related family member 1,Cdhr1,Kiaa1775,MT-protocadherin,Pcdh21,Photoreceptor cadherin,prCAD,Prcad,Protocadherin-21,Rat,Rattus norvegicus
U1615h CLIA Cadherin-like protein 1,Homo sapiens,Human,PC42,PCDH1,Protocadherin-1,Protocadherin-42 96T
E1615h ELISA kit Cadherin-like protein 1,Homo sapiens,Human,PC42,PCDH1,Protocadherin-1,Protocadherin-42 96T
E1615h ELISA Cadherin-like protein 1,Homo sapiens,Human,PC42,PCDH1,Protocadherin-1,Protocadherin-42 96T
26-204 PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplas 0.05 mg
EIAAB30049 Homo sapiens,Human,PCDH12,Protocadherin-12,UNQ395_PRO731,Vascular cadherin-2,Vascular endothelial cadherin-2,VE-cad-2,VE-cadherin-2
EIAAB30050 Mouse,Mus musculus,Pcdh12,Protocadherin-12,Vascular cadherin-2,Vascular endothelial cadherin-2,VE-cad-2,VE-cadherin-2
EIAAB14458 FAT tumor suppressor homolog 4,Fat4,Fatj,Fat-like cadherin protein FAT-J,Mouse,Mus musculus,Protocadherin Fat 4
U1902h CLIA Cadherin-13,CDH13,CDHH,H-cadherin,Heart cadherin,Homo sapiens,Human,P105,T-cad,T-cadherin,Truncated cadherin 96T
E1902h ELISA Cadherin-13,CDH13,CDHH,H-cadherin,Heart cadherin,Homo sapiens,Human,P105,T-cad,T-cadherin,Truncated cadherin 96T
E1902h ELISA kit Cadherin-13,CDH13,CDHH,H-cadherin,Heart cadherin,Homo sapiens,Human,P105,T-cad,T-cadherin,Truncated cadherin 96T
U1902h CLIA kit Cadherin-13,CDH13,CDHH,H-cadherin,Heart cadherin,Homo sapiens,Human,P105,T-cad,T-cadherin,Truncated cadherin 96T
EIAAB05075 Brain cadherin,BR-cadherin,Cadherin-12,CDH12,Homo sapiens,Human,N-cadherin 2,Neural type cadherin 2
E1902m ELISA Cadherin-13,Cdh13,H-cadherin,Heart cadherin,Mouse,Mus musculus,T-cad,T-cadherin,Truncated cadherin 96T
E1902m ELISA kit Cadherin-13,Cdh13,H-cadherin,Heart cadherin,Mouse,Mus musculus,T-cad,T-cadherin,Truncated cadherin 96T
U1902m CLIA kit Cadherin-13,Cdh13,H-cadherin,Heart cadherin,Mouse,Mus musculus,T-cad,T-cadherin,Truncated cadherin 96T
U1902m CLIA Cadherin-13,Cdh13,H-cadherin,Heart cadherin,Mouse,Mus musculus,T-cad,T-cadherin,Truncated cadherin 96T
EIAAB30112 Cadherin-20,CDH20,FIB2,Fibroblast cadherin-2,Homo sapiens,Human,PCDH-gamma-B4,PCDHGB4,Protocadherin gamma-B4


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur