Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Raf homolog serine/threonine-protein kinase (EC 2.7.11.1) (Abnormal cell lineage protein 45)

 KRAF1_CAEEL             Reviewed;         813 AA.
Q07292; Q6RT23; Q8MXT8; Q9N4E3;
01-OCT-1994, integrated into UniProtKB/Swiss-Prot.
11-JUL-2002, sequence version 2.
25-OCT-2017, entry version 159.
RecName: Full=Raf homolog serine/threonine-protein kinase;
EC=2.7.11.1;
AltName: Full=Abnormal cell lineage protein 45;
Name=lin-45; Synonyms=raf-1; ORFNames=Y73B6A.5;
Caenorhabditis elegans.
Eukaryota; Metazoa; Ecdysozoa; Nematoda; Chromadorea; Rhabditida;
Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
NCBI_TaxID=6239;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), AND FUNCTION.
STRAIN=Bristol N2;
PubMed=8483497; DOI=10.1038/363133a0;
Han M., Golden A., Han Y., Sternberg P.W.;
"C. elegans lin-45 raf gene participates in let-60 ras-stimulated
vulval differentiation.";
Nature 363:133-140(1993).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND C).
PubMed=15105376; DOI=10.1101/gad.1188404;
Lee M.-H., Schedl T.;
"Translation repression by GLD-1 protects its mRNA targets from
nonsense-mediated mRNA decay in C. elegans.";
Genes Dev. 18:1047-1059(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND ALTERNATIVE
SPLICING.
STRAIN=Bristol N2;
PubMed=9851916; DOI=10.1126/science.282.5396.2012;
The C. elegans sequencing consortium;
"Genome sequence of the nematode C. elegans: a platform for
investigating biology.";
Science 282:2012-2018(1998).
[4]
FUNCTION, AND MUTAGENESIS OF PRO-92; ARG-108; ARG-118; SER-645;
ILE-726 AND SER-754.
PubMed=11861555;
Hsu V., Zobel C.L., Lambie E.J., Schedl T., Kornfeld K.;
"Caenorhabditis elegans lin-45 raf is essential for larval viability,
fertility and the induction of vulval cell fates.";
Genetics 160:481-492(2002).
[5]
FUNCTION.
PubMed=15268855; DOI=10.1016/j.cub.2004.07.022;
Nicholas H.R., Hodgkin J.;
"The ERK MAP kinase cascade mediates tail swelling and a protective
response to rectal infection in C. elegans.";
Curr. Biol. 14:1256-1261(2004).
[6]
FUNCTION, AND MUTAGENESIS OF SER-312 AND SER-453.
PubMed=14724126; DOI=10.1242/dev.00987;
Kao G., Tuck S., Baillie D., Sundaram M.V.;
"C. elegans SUR-6/PR55 cooperates with LET-92/protein phosphatase 2A
and promotes Raf activity independently of inhibitory Akt
phosphorylation sites.";
Development 131:755-765(2004).
[7]
INTERACTION WITH CDF-1.
PubMed=15096503; DOI=10.1074/jbc.M401210200;
Jirakulaporn T., Muslin A.J.;
"Cation diffusion facilitator proteins modulate Raf-1 activity.";
J. Biol. Chem. 279:27807-27815(2004).
[8]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=19826475; DOI=10.1371/journal.pone.0007450;
Schouest K.R., Kurasawa Y., Furuta T., Hisamoto N., Matsumoto K.,
Schumacher J.M.;
"The germinal center kinase GCK-1 is a negative regulator of MAP
kinase activation and apoptosis in the C. elegans germline.";
PLoS ONE 4:E7450-E7450(2009).
[9]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=20624915; DOI=10.1074/jbc.M110.146274;
Okuyama T., Inoue H., Ookuma S., Satoh T., Kano K., Honjoh S.,
Hisamoto N., Matsumoto K., Nishida E.;
"The ERK-MAPK pathway regulates longevity through SKN-1 and insulin-
like signaling in Caenorhabditis elegans.";
J. Biol. Chem. 285:30274-30281(2010).
-!- FUNCTION: Protein kinase that participates in the induction of
vulva and has roles in fertility and viability. Acts downstream of
the Ras protein let-60 (PubMed:8483497, PubMed:11861555,
PubMed:14724126). Required for progression of developing oocytes
through the pachytene stage (PubMed:19826475). Plays a role in
responses to M.nematophilum-mediated bacterial infection by
promoting tail swelling and preventing constipation
(PubMed:15268855). Positively regulates lifespan upstream of mek-2
and mpk-1 (PubMed:20624915). {ECO:0000269|PubMed:11861555,
ECO:0000269|PubMed:14724126, ECO:0000269|PubMed:15268855,
ECO:0000269|PubMed:19826475, ECO:0000269|PubMed:8483497}.
-!- CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
-!- COFACTOR:
Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250};
Note=Binds 2 Zn(2+) ions per subunit. {ECO:0000250};
-!- SUBUNIT: Interacts with cdf-1 in a zinc-dependent manner which
promotes its activity. {ECO:0000269|PubMed:15096503}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=a;
IsoId=Q07292-1; Sequence=Displayed;
Name=b;
IsoId=Q07292-2; Sequence=VSP_020620, VSP_020622, VSP_020623;
Note=No experimental confirmation available.;
Name=c;
IsoId=Q07292-3; Sequence=VSP_020621;
-!- DISRUPTION PHENOTYPE: RNAi-mediated knockdown causes a defect in
pachytene progression resulting in a proximal gonad devoid of
nuclei. The phenotype is more severe in gck-1 (km15) mutant
(PubMed:19826475). RNAi-mediated knockdown in adults decreases
lifespan (PubMed:20624915). {ECO:0000269|PubMed:19826475,
ECO:0000269|PubMed:20624915}.
-!- MISCELLANEOUS: Gld-1 binds to the 3'-UTR of lin-45 mRNA and is
able to protect nonsense-containing lin-45 mRNA from nonsense
mediated decay (NMD).
-!- SIMILARITY: Belongs to the protein kinase superfamily. TKL Ser/Thr
protein kinase family. RAF subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L15347; AAA28142.1; -; mRNA.
EMBL; AY455928; AAR26307.1; -; mRNA.
EMBL; AY493413; AAR86712.1; -; mRNA.
EMBL; AY493414; AAR86713.1; -; mRNA.
EMBL; FO080249; CCD62343.1; -; Genomic_DNA.
EMBL; FO080249; CCD62344.1; -; Genomic_DNA.
PIR; S33261; S33261.
RefSeq; NP_001293844.1; NM_001306915.1. [Q07292-3]
RefSeq; NP_741430.3; NM_171367.5. [Q07292-1]
RefSeq; NP_741431.2; NM_171368.2.
UniGene; Cel.18190; -.
ProteinModelPortal; Q07292; -.
SMR; Q07292; -.
BioGrid; 42556; 18.
IntAct; Q07292; 4.
MINT; MINT-1055674; -.
STRING; 6239.Y73B6A.5a.2; -.
iPTMnet; Q07292; -.
EPD; Q07292; -.
PaxDb; Q07292; -.
PeptideAtlas; Q07292; -.
EnsemblMetazoa; Y73B6A.5a.1; Y73B6A.5a.1; WBGene00003030. [Q07292-1]
EnsemblMetazoa; Y73B6A.5a.2; Y73B6A.5a.2; WBGene00003030. [Q07292-1]
GeneID; 177436; -.
UCSC; Y73B6A.5a.1; c. elegans. [Q07292-1]
CTD; 177436; -.
WormBase; Y73B6A.5a; CE25585; WBGene00003030; lin-45. [Q07292-1]
WormBase; Y73B6A.5b; CE49395; WBGene00003030; lin-45.
eggNOG; KOG0193; Eukaryota.
eggNOG; ENOG410Y4UP; LUCA.
GeneTree; ENSGT00900000140880; -.
HOGENOM; HOG000252972; -.
InParanoid; Q07292; -.
OrthoDB; EOG091G09SB; -.
PhylomeDB; Q07292; -.
Reactome; R-CEL-2672351; Stimuli-sensing channels.
Reactome; R-CEL-392517; Rap1 signalling.
Reactome; R-CEL-430116; GP1b-IX-V activation signalling.
Reactome; R-CEL-442742; CREB phosphorylation through the activation of Ras.
Reactome; R-CEL-5621575; CD209 (DC-SIGN) signaling.
Reactome; R-CEL-5673000; RAF activation.
Reactome; R-CEL-5674135; MAP2K and MAPK activation.
Reactome; R-CEL-5674499; Negative feedback regulation of MAPK pathway.
Reactome; R-CEL-5675221; Negative regulation of MAPK pathway.
SignaLink; Q07292; -.
PRO; PR:Q07292; -.
Proteomes; UP000001940; Chromosome IV.
Bgee; WBGene00003030; -.
ExpressionAtlas; Q07292; baseline.
GO; GO:0005622; C:intracellular; IBA:GO_Central.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0004709; F:MAP kinase kinase kinase activity; IBA:GO_Central.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0031434; F:mitogen-activated protein kinase kinase binding; IBA:GO_Central.
GO; GO:0017016; F:Ras GTPase binding; IPI:WormBase.
GO; GO:0001708; P:cell fate specification; IMP:WormBase.
GO; GO:0051321; P:meiotic cell cycle; IEA:UniProtKB-KW.
GO; GO:0043066; P:negative regulation of apoptotic process; IBA:GO_Central.
GO; GO:0009968; P:negative regulation of signal transduction; IBA:GO_Central.
GO; GO:0002119; P:nematode larval development; IMP:WormBase.
GO; GO:0048477; P:oogenesis; IEA:UniProtKB-KW.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IBA:GO_Central.
GO; GO:0007265; P:Ras protein signal transduction; IGI:WormBase.
GO; GO:0000003; P:reproduction; IMP:WormBase.
GO; GO:0040025; P:vulval development; IMP:UniProtKB.
CDD; cd00029; C1; 1.
InterPro; IPR011009; Kinase-like_dom.
InterPro; IPR002219; PE/DAG-bd.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR017441; Protein_kinase_ATP_BS.
InterPro; IPR003116; RBD_dom.
InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom.
InterPro; IPR008271; Ser/Thr_kinase_AS.
InterPro; IPR029071; Ubiquitin-rel_dom.
Pfam; PF00130; C1_1; 1.
Pfam; PF07714; Pkinase_Tyr; 1.
Pfam; PF02196; RBD; 1.
SMART; SM00109; C1; 1.
SMART; SM00455; RBD; 1.
SMART; SM00220; S_TKc; 1.
SUPFAM; SSF54236; SSF54236; 1.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
PROSITE; PS00108; PROTEIN_KINASE_ST; 1.
PROSITE; PS50898; RBD; 1.
PROSITE; PS00479; ZF_DAG_PE_1; 1.
PROSITE; PS50081; ZF_DAG_PE_2; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Complete proteome;
Developmental protein; Differentiation; Kinase; Meiosis;
Metal-binding; Nucleotide-binding; Oogenesis; Reference proteome;
Serine/threonine-protein kinase; Transferase; Zinc; Zinc-finger.
CHAIN 1 813 Raf homolog serine/threonine-protein
kinase.
/FTId=PRO_0000086193.
DOMAIN 85 161 RBD. {ECO:0000255|PROSITE-
ProRule:PRU00262}.
DOMAIN 481 748 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
ZN_FING 170 217 Phorbol-ester/DAG-type.
{ECO:0000255|PROSITE-ProRule:PRU00226}.
NP_BIND 487 495 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
ACT_SITE 602 602 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159, ECO:0000255|PROSITE-
ProRule:PRU10027}.
METAL 184 184 Zinc 2. {ECO:0000250}.
METAL 187 187 Zinc 2. {ECO:0000250}.
METAL 198 198 Zinc 1. {ECO:0000250}.
METAL 201 201 Zinc 1. {ECO:0000250}.
METAL 206 206 Zinc 2. {ECO:0000250}.
METAL 209 209 Zinc 2. {ECO:0000250}.
METAL 217 217 Zinc 1. {ECO:0000250}.
BINDING 507 507 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
VAR_SEQ 1 44 Missing (in isoform c).
{ECO:0000303|PubMed:15105376}.
/FTId=VSP_020621.
VAR_SEQ 1 1 M -> MSAMAVLYSVCHFHGGWNRRKSAPKSPVTSSQTPSS
SSTRRRM (in isoform b). {ECO:0000305}.
/FTId=VSP_020620.
VAR_SEQ 569 572 EPRV -> GDLN (in isoform b).
{ECO:0000305}.
/FTId=VSP_020622.
VAR_SEQ 573 813 Missing (in isoform b). {ECO:0000305}.
/FTId=VSP_020623.
MUTAGEN 92 92 P->S: In n2018; 76% larval lethal, 24%
abnormal vulval development.
{ECO:0000269|PubMed:11861555}.
MUTAGEN 108 108 R->W: In n1925; no effect.
{ECO:0000269|PubMed:11861555}.
MUTAGEN 118 118 R->W: In n2506; 86% larval lethal, 93%
abnormal vulval development.
{ECO:0000269|PubMed:11861555}.
MUTAGEN 312 312 S->A: Probably abolishes phosphorylation.
Multivulva formation. Multivulva
formation; when associated with A-453.
{ECO:0000269|PubMed:14724126}.
MUTAGEN 453 453 S->A: Probably abolishes phosphorylation.
Multivulva formation; when associated
with A-312.
{ECO:0000269|PubMed:14724126}.
MUTAGEN 645 645 S->N: In oz178 and oz201; 55% larval
lethal, 100% abnormal vulval development.
{ECO:0000269|PubMed:11861555}.
MUTAGEN 726 726 I->F: In n1924; 5% larval lethal, no
effect on vulval development.
{ECO:0000269|PubMed:11861555}.
MUTAGEN 754 754 S->F: In n2520 and n2523; no effect.
{ECO:0000269|PubMed:11861555}.
CONFLICT 801 801 A -> R (in Ref. 1; AAA28142).
{ECO:0000305}.
SEQUENCE 813 AA; 90407 MW; 6376E968D11A9E49 CRC64;
MSRINFKKSS ASTTPTSPHC PSPRLISLPR CASSSIDRKD QASPMASPST PLYPKHSDSL
HSLSGHHSAG GAGTSDKEPP KFKYKMIMVH LPFDQHSRVE VRPGETARDA ISKLLKKRNI
TPQLCHVNAS SDPKQESIEL SLTMEEIASR LPGNELWVHS EYLNTVSSIK HAIVRRTFIP
PKSCDVCNNP IWMMGFRCEF CQFKFHQRCS SFAPLYCDLL QSVPKNEDLV KELFGIASQV
EGPDRSVAEI VLANLAPTSG QSPAATPDSS HPDLTSIKRT GGVKRHPMAV SPQNETSQLS
PSGPYPRDRS SSAPNINAIN DEATVQHNQR ILDALEAQRL EEESRDKTGS LLSTQARHRP
HFQSGHILSG ARMNRLHPLV DCTPLGSNSP SSTCSSPPGG LIGQPTLGQS PNVSGSTTSS
LVAAHLHTLP LTPPQSAPPQ KISPGFFRNR SRSPGERLDA QRPRPPQKPH HEDWEILPNE
FIIQYKVGSG SFGTVYRGEF FGTVAIKKLN VVDPTPSQMA AFKNEVAVLK KTRHLNVLLF
MGWVREPEIA IITQWCEGSS LYRHIHVQEP RVEFEMGAII DILKQVSLGM NYLHSKNIIH
RDLKTNNIFL MDDMSTVKIG DFGLATVKTK WTVNGGQQQQ QPTGSILWMA PEVIRMQDDN
PYTPQSDVYS FGICMYEILS SHLPYSNINN RDQILFMVGR GYLRPDRSKI RHDTPKSMLK
LYDNCIMFDR NERPVFGEVL ERLRDIILPK LTRSQSAPNV LHLDSQYSVM DAVMRSQMLS
WSYIPPATAK TPQSAAAAAA ANKKAYYNVY GLI


Related products :

Catalog number Product name Quantity
EIAAB31334 Bos taurus,Bovine,PKN,PKN1,PRK1,PRKCL1,Protein kinase C-like 1,Protein kinase C-like PKN,Protein kinase PKN-alpha,Protein-kinase C-related kinase 1,Serine_threonine-protein kinase N1,Serine-threonine
EIAAB31332 Mouse,Mus musculus,Pkn,Pkn1,Prk1,Prkcl1,Protein kinase C-like 1,Protein kinase C-like PKN,Protein-kinase C-related kinase 1,Serine_threonine-protein kinase N1,Serine-threonine protein kinase N
CCD23_BOVIN Mouse ELISA Kit FOR Serine per threonine-protein kinase PRP4 homolog 96T
PRP4B_HUMAN Human ELISA Kit FOR Serine per threonine-protein kinase PRP4 homolog 96T
TM141_MOUSE Mouse ELISA Kit FOR Serine per threonine-protein kinase PRP4 homolog 96T
E0071m Mouse ELISA Kit FOR Serine per threonine-protein kinase PRP4 homolog 96T
H0317 Serine threonine-protein kinase PRP4 homolog (PRPF4B), Rat, ELISA Kit 96T
H0316 Serine threonine-protein kinase PRP4 homolog (PRPF4B), Mouse, ELISA Kit 96T
H0315 Serine threonine-protein kinase PRP4 homolog (PRPF4B), Human, ELISA Kit 96T
H0314 Serine threonine-protein kinase PRP4 homolog (PRPF4B), Bovine, ELISA Kit 96T
PRP4B_RAT ELISA Kit FOR Serine per threonine-protein kinase PRP4 homolog; organism: Rat; gene name: Prpf4b 96T
PRP4B_MOUSE ELISA Kit FOR Serine per threonine-protein kinase PRP4 homolog; organism: Mouse; gene name: Prpf4b 96T
ATGP3205 Serine per threonine-protein kinase receptor R3, 22-118aa, Human, His tag, Insect cell 50ug
ATGP3205 Serine per threonine-protein kinase receptor R3, 22-118aa, Human, His tag, Insect cell 250ug
GWB-CEE83D Serine threonine-protein kinase SNF1-like kinase 2 (SNF1LK2) Salt-inducible protein kinase 2 (SIK2) Rabbit anti-Human Polyclonal
GWB-5BE1E2 Serine threonine-protein kinase SNF1-like kinase 2 (SNF1LK2) Salt-inducible protein kinase 2 (SIK2) Mouse anti-Human Monoclonal
EIAAB40405 Homo sapiens,Human,MAP activator with WD repeats,MAWD,Serine-threonine kinase receptor-associated protein,STRAP,UNR-interacting protein,UNRIP,WD-40 repeat protein PT-WD
G9795 Serine threonine-protein kinase 11-interacting protein (STK11IP), Mouse, ELISA Kit 96T
G9794 Serine threonine-protein kinase 11-interacting protein (STK11IP), Human, ELISA Kit 96T
G9793 Serine threonine-protein kinase 11-interacting protein (STK11IP), Chicken, ELISA Kit 96T
MKNK1_RAT Rat ELISA Kit FOR MAP kinase-interacting serine per threonine-protein kinase 1 96T
S11IP_MOUSE ELISA Kit FOR Serine per threonine-protein kinase 11-interacting protein; organism: Mouse; gene name: Stk11ip 96T
EIAAB40408 Rat,Rattus norvegicus,Serine-threonine kinase receptor-associated protein,Strap,UNR-interacting protein,Unrip
EIAAB40407 Mouse,Mus musculus,Serine-threonine kinase receptor-associated protein,Strap,UNR-interacting protein,Unrip
31-052 AKT1 is a general protein kinase capable of phosphorylating several known proteins.The serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and i 0.05 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur