Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Regulator of G-protein signaling 20 (RGS20) (Gz-selective GTPase-activating protein) (G(z)GAP) (Gz-GAP) (Regulator of G-protein signaling Z1) (Regulator of Gz-selective protein signaling 1)

 RGS20_HUMAN             Reviewed;         388 AA.
O76081; Q96BG9;
20-JUN-2001, integrated into UniProtKB/Swiss-Prot.
18-OCT-2001, sequence version 4.
25-OCT-2017, entry version 165.
RecName: Full=Regulator of G-protein signaling 20;
Short=RGS20;
AltName: Full=Gz-selective GTPase-activating protein;
Short=G(z)GAP;
Short=Gz-GAP;
AltName: Full=Regulator of G-protein signaling Z1;
AltName: Full=Regulator of Gz-selective protein signaling 1;
Name=RGS20; Synonyms=RGSZ1, ZGAP1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), AND CHARACTERIZATION.
TISSUE=Fetal brain;
PubMed=9748280; DOI=10.1074/jbc.273.40.26014;
Wang J., Ducret A., Tu Y., Kozasa T., Aebersold R., Ross E.M.;
"RGSZ1, a Gz-selective RGS protein in brain. Structure, membrane
association, regulation by Galphaz phosphorylation, and relationship
to a Gz GTPase-activating protein subfamily.";
J. Biol. Chem. 273:26014-26025(1998).
[2]
SEQUENCE REVISION TO N-TERMINUS.
Wang J., Ducret A., Ross E.M.;
Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 6).
TISSUE=Retina;
PubMed=11735229; DOI=10.1006/geno.2001.6659;
Barker S.A., Wang J., Sierra D.A., Ross E.M.;
"RGSZ1 and Ret RGS: two of several splice variants from the gene
RGS20.";
Genomics 78:223-229(2001).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Puhl H.L. III, Ikeda S.R., Aronstam R.S.;
"cDNA clones of human proteins involved in signal transduction
sequenced by the Guthrie cDNA resource center (www.cdna.org).";
Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
TISSUE=Fetal brain, and Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 57-388 (ISOFORM 1).
PubMed=9748279; DOI=10.1074/jbc.273.40.26008;
Glick J.L., Meigs T.E., Miron A., Casey P.J.;
"RGSZ1, a Gz-selective regulator of G protein signaling whose action
is sensitive to the phosphorylation state of Gzalpha.";
J. Biol. Chem. 273:26008-26013(1998).
[7]
FUNCTION.
PubMed=12379657; DOI=10.1074/jbc.M206116200;
Wang Y., Ho G., Zhang J.J., Nieuwenhuijsen B., Edris W., Chanda P.K.,
Young K.H.;
"Regulator of G protein signaling Z1 (RGSZ1) interacts with Galpha i
subunits and regulates Galpha i-mediated cell signaling.";
J. Biol. Chem. 277:48325-48332(2002).
-!- FUNCTION: Inhibits signal transduction by increasing the GTPase
activity of G protein alpha subunits thereby driving them into
their inactive GDP-bound form. Binds selectively to G(z)-alpha and
G(alpha)-i2 subunits, accelerates their GTPase activity and
regulates their signaling activities. The G(z)-alpha activity is
inhibited by the phosphorylation and palmitoylation of the G-
protein. Negatively regulates mu-opioid receptor-mediated
activation of the G-proteins (By similarity). {ECO:0000250,
ECO:0000269|PubMed:12379657}.
-!- SUBUNIT: Forms a complex with G(alpha)z/i2 subunits and mu-opioid
receptors; the formation of this complex results in mu-opioid
receptor desensitization. Interacts with OPRM1 (By similarity).
{ECO:0000250}.
-!- INTERACTION:
Q9NWL9:-; NbExp=3; IntAct=EBI-10178530, EBI-10315054;
P29972:AQP1; NbExp=3; IntAct=EBI-1052678, EBI-745213;
Q8NEC5:CATSPER1; NbExp=4; IntAct=EBI-1052678, EBI-744545;
Q9UGL9:CRCT1; NbExp=5; IntAct=EBI-10178530, EBI-713677;
Q02930-3:CREB5; NbExp=5; IntAct=EBI-10178530, EBI-10192698;
P48023:FASLG; NbExp=5; IntAct=EBI-10178530, EBI-495538;
O76003:GLRX3; NbExp=3; IntAct=EBI-10178530, EBI-374781;
P04899:GNAI2; NbExp=3; IntAct=EBI-10178530, EBI-353997;
P49639:HOXA1; NbExp=3; IntAct=EBI-1052678, EBI-740785;
P09022:Hoxa1 (xeno); NbExp=3; IntAct=EBI-1052678, EBI-3957603;
P10809:HSPD1; NbExp=3; IntAct=EBI-1052678, EBI-352528;
I3WAC9:INS; NbExp=3; IntAct=EBI-10178530, EBI-10178524;
Q2WGJ6:KLHL38; NbExp=3; IntAct=EBI-1052678, EBI-6426443;
Q9BYR5:KRTAP4-2; NbExp=5; IntAct=EBI-10178530, EBI-10172511;
Q6L8G9:KRTAP5-6; NbExp=5; IntAct=EBI-10178530, EBI-10250562;
P26371:KRTAP5-9; NbExp=5; IntAct=EBI-10178530, EBI-3958099;
Q5T7P3:LCE1B; NbExp=5; IntAct=EBI-10178530, EBI-10245913;
Q5TA79:LCE2A; NbExp=3; IntAct=EBI-10178530, EBI-10246607;
O14633:LCE2B; NbExp=4; IntAct=EBI-10178530, EBI-11478468;
Q5TA82:LCE2D; NbExp=3; IntAct=EBI-1052678, EBI-10246750;
Q5T5B0:LCE3E; NbExp=5; IntAct=EBI-10178530, EBI-10245456;
Q5TA78:LCE4A; NbExp=5; IntAct=EBI-10178530, EBI-10246358;
O60336:MAPKBP1; NbExp=3; IntAct=EBI-10178530, EBI-947402;
P48039:MTNR1A; NbExp=6; IntAct=EBI-1052678, EBI-1188238;
P49286:MTNR1B; NbExp=2; IntAct=EBI-1052678, EBI-1188341;
Q9NQS3:NECTIN3; NbExp=3; IntAct=EBI-1052678, EBI-2826725;
P32242:OTX1; NbExp=4; IntAct=EBI-1052678, EBI-740446;
P43115-12:PTGER3; NbExp=3; IntAct=EBI-10178530, EBI-10234038;
Q8WUK0:PTPMT1; NbExp=5; IntAct=EBI-10178530, EBI-7199479;
-!- SUBCELLULAR LOCATION: Membrane; Lipid-anchor. Nucleus. Cytoplasm.
Note=Shuttles between the cytoplasm/cell membrane and the nucleus.
Anchored to the membrane through palmitoylation. {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=6;
IsoId=O76081-1; Sequence=Displayed;
Name=1;
IsoId=O76081-2; Sequence=VSP_005696;
Name=2;
IsoId=O76081-3; Sequence=VSP_005697, VSP_005699;
Name=3;
IsoId=O76081-4; Sequence=VSP_005698, VSP_005700;
Name=4;
IsoId=O76081-5; Sequence=VSP_005695, VSP_005696;
Name=5;
IsoId=O76081-6; Sequence=VSP_005694, VSP_005696;
-!- TISSUE SPECIFICITY: Isoform 5 is expressed in brain at high levels
in the caudate nucleus and temporal lobe.
-!- PTM: Fatty acylated. Heavily palmitoylated in the cysteine string
motif (By similarity). {ECO:0000250}.
-!- PTM: N- and O-glycosylated in synapsomal membranes. {ECO:0000250}.
-!- PTM: Serine phosphorylated in synapsomal membranes. {ECO:0000250}.
-!- PTM: Sumoylated with SUMO1 and SUMO2 in synaptosomes. The
sumoylated forms act as a scaffold for sequestering mu-opioid
receptor-activated G(alpha) subunits (By similarity).
{ECO:0000250}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF060877; AAC62009.2; -; mRNA.
EMBL; AF366054; AAK54122.1; -; mRNA.
EMBL; AF366055; AAK54123.1; -; mRNA.
EMBL; AF366056; AAK54124.1; -; mRNA.
EMBL; AF366057; AAK54125.1; -; mRNA.
EMBL; AF074979; AAC62013.1; -; mRNA.
EMBL; AF493940; AAM12654.1; -; mRNA.
EMBL; BC015614; AAH15614.2; -; mRNA.
EMBL; BC063490; AAH63490.1; -; mRNA.
EMBL; AY046538; AAL03971.1; -; mRNA.
CCDS; CCDS6155.1; -. [O76081-1]
CCDS; CCDS6156.1; -. [O76081-6]
CCDS; CCDS69482.1; -. [O76081-2]
RefSeq; NP_001273602.1; NM_001286673.1. [O76081-2]
RefSeq; NP_001273603.1; NM_001286674.1. [O76081-4]
RefSeq; NP_001273604.1; NM_001286675.1. [O76081-3]
RefSeq; NP_003693.2; NM_003702.4. [O76081-6]
RefSeq; NP_733466.1; NM_170587.3. [O76081-1]
RefSeq; XP_011515924.1; XM_011517622.2.
UniGene; Hs.368733; -.
ProteinModelPortal; O76081; -.
SMR; O76081; -.
BioGrid; 114161; 85.
CORUM; O76081; -.
IntAct; O76081; 50.
MINT; MINT-3002244; -.
STRING; 9606.ENSP00000297313; -.
iPTMnet; O76081; -.
PhosphoSitePlus; O76081; -.
SwissPalm; O76081; -.
MaxQB; O76081; -.
PaxDb; O76081; -.
PeptideAtlas; O76081; -.
PRIDE; O76081; -.
DNASU; 8601; -.
Ensembl; ENST00000276500; ENSP00000276500; ENSG00000147509. [O76081-6]
Ensembl; ENST00000297313; ENSP00000297313; ENSG00000147509. [O76081-1]
Ensembl; ENST00000344277; ENSP00000344630; ENSG00000147509. [O76081-2]
GeneID; 8601; -.
KEGG; hsa:8601; -.
UCSC; uc003xrp.5; human. [O76081-1]
CTD; 8601; -.
DisGeNET; 8601; -.
EuPathDB; HostDB:ENSG00000147509.13; -.
GeneCards; RGS20; -.
HGNC; HGNC:14600; RGS20.
MIM; 607193; gene.
neXtProt; NX_O76081; -.
OpenTargets; ENSG00000147509; -.
PharmGKB; PA34373; -.
eggNOG; KOG3589; Eukaryota.
eggNOG; ENOG410YMJD; LUCA.
GeneTree; ENSGT00760000118903; -.
HOGENOM; HOG000233513; -.
HOVERGEN; HBG013233; -.
InParanoid; O76081; -.
KO; K16449; -.
OMA; FRAQRYN; -.
OrthoDB; EOG091G0BDG; -.
PhylomeDB; O76081; -.
TreeFam; TF315837; -.
Reactome; R-HSA-418594; G alpha (i) signalling events.
Reactome; R-HSA-418597; G alpha (z) signalling events.
ChiTaRS; RGS20; human.
GeneWiki; RGS20; -.
GenomeRNAi; 8601; -.
PRO; PR:O76081; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000147509; -.
CleanEx; HS_RGS20; -.
ExpressionAtlas; O76081; baseline and differential.
Genevisible; O76081; HS.
GO; GO:0005737; C:cytoplasm; IMP:CACAO.
GO; GO:0031410; C:cytoplasmic vesicle; IBA:GO_Central.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0005802; C:trans-Golgi network; IMP:CACAO.
GO; GO:0005096; F:GTPase activator activity; TAS:ProtInc.
GO; GO:0009968; P:negative regulation of signal transduction; IEA:UniProtKB-KW.
GO; GO:0008277; P:regulation of G-protein coupled receptor protein signaling pathway; TAS:ProtInc.
Gene3D; 1.10.196.10; -; 2.
InterPro; IPR016137; RGS.
InterPro; IPR036305; RGS_sf.
InterPro; IPR024066; RGS_subdom1.
Pfam; PF00615; RGS; 1.
PRINTS; PR01301; RGSPROTEIN.
SMART; SM00315; RGS; 1.
SUPFAM; SSF48097; SSF48097; 1.
PROSITE; PS50132; RGS; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Glycoprotein;
Lipoprotein; Membrane; Nucleus; Palmitate; Phosphoprotein;
Reference proteome; Signal transduction inhibitor; Ubl conjugation.
CHAIN 1 388 Regulator of G-protein signaling 20.
/FTId=PRO_0000204233.
DOMAIN 262 378 RGS. {ECO:0000255|PROSITE-
ProRule:PRU00171}.
COMPBIAS 208 220 Poly-Cys.
VAR_SEQ 1 236 Missing (in isoform 3).
{ECO:0000303|PubMed:11735229}.
/FTId=VSP_005698.
VAR_SEQ 1 208 Missing (in isoform 2).
{ECO:0000303|PubMed:11735229}.
/FTId=VSP_005697.
VAR_SEQ 1 55 MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQI
TENEGDLRAVPDIK -> MRTADGGEPAGASSPAGRVDGGL
(in isoform 5).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:9748280}.
/FTId=VSP_005694.
VAR_SEQ 3 55 Missing (in isoform 4).
{ECO:0000303|PubMed:11735229,
ECO:0000303|Ref.4}.
/FTId=VSP_005695.
VAR_SEQ 56 170 Missing (in isoform 1, isoform 4 and
isoform 5). {ECO:0000303|PubMed:11735229,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:9748279,
ECO:0000303|PubMed:9748280,
ECO:0000303|Ref.4}.
/FTId=VSP_005696.
VAR_SEQ 209 220 CFCWCCCCSCSC -> MKETSGLFLISS (in isoform
2). {ECO:0000303|PubMed:11735229}.
/FTId=VSP_005699.
VAR_SEQ 237 247 ELRADLPTWEE -> MKETSGLFLIS (in isoform
3). {ECO:0000303|PubMed:11735229}.
/FTId=VSP_005700.
SEQUENCE 388 AA; 43692 MW; F44796D271F1765F CRC64;
MPQLSQDNQE CLQKHFSRPS IWTQFLPLFR AQRYNTDIHQ ITENEGDLRA VPDIKSFPPA
QLPDSPAAPK LFGLLSSPLS SLARFFSHLL RRPPPEAPRR RLDFSPLLPA LPAARLSRGH
EELPGRLSLL LGAALALPGR PSGGRPLRPP HPVAKPREED ATAGQSSPMP QMGSERMEMR
KRQMPAAQDT PGAAPGQPGA GSRGSNACCF CWCCCCSCSC LTVRNQEDQR PTIASHELRA
DLPTWEESPA PTLEEVNAWA QSFDKLMVTP AGRNAFREFL RTEFSEENML FWMACEELKK
EANKNIIEEK ARIIYEDYIS ILSPKEVSLD SRVREVINRN MVEPSQHIFD DAQLQIYTLM
HRDSYPRFMN SAVYKDLLQS LSEKSIEA


Related products :

Catalog number Product name Quantity
EIAAB34563 G(z)GAP,Gz-GAP,Gz-selective GTPase-activating protein,Homo sapiens,Human,Regulator of G-protein signaling 20,Regulator of G-protein signaling Z1,Regulator of Gz-selective protein signaling 1,RGS20,RGS
15-288-22893 Regulator of G-protein signaling 20 - RGS20; Regulator of Gz-selective protein signaling 1; Gz-selective GTPase-activating protein; G(z)GAP Polyclonal 0.1 mg
15-288-22893 Regulator of G-protein signaling 20 - RGS20; Regulator of Gz-selective protein signaling 1; Gz-selective GTPase-activating protein; G(z)GAP Polyclonal 0.05 mg
18-003-42468 Regulator of G-protein signaling 20 - RGS20; Regulator of Gz-selective protein signaling 1; Gz-selective GTPase-activating protein; G(z)GAP Polyclonal 0.1 mg Protein A
18-003-42467 Regulator of G-protein signaling 20 - RGS20; Regulator of Gz-selective protein signaling 1; Gz-selective GTPase-activating protein; G(z)GAP Polyclonal 0.1 mg Protein A
EIAAB34565 Chicken,G(z)GAP,Gallus gallus,Gz-GAP,Gz-selective GTPase-activating protein,Regulator of G-protein signaling 20,RGS20,RGS20
EIAAB34564 Bos taurus,Bovine,Regulator of G-protein signaling 20,Retina-specific regulator of G-protein signaling 1,Ret-RGS1,RGS20,RGS20
EIAAB34562 Mouse,Mus musculus,Regulator of G-protein signaling 20,Regulator of G-protein signaling Z1,RGS20,Rgs20,Rgsz1
EIAAB34547 Mouse,Mus musculus,Regulator of G-protein signaling 17,Regulator of Gz-selective protein signaling 2,RGS17,Rgs17,Rgsz2
29-804 RGS8 is a member of the regulator of G protein signaling (RGS) family and is a protein with a single RGS domain. Regulator of G protein signaling (RGS) proteins are regulatory and structural component 0.1 mg
15-288-21321 Regulator of G-protein signaling 16 - RGS16; Retinally abundant regulator of G-protein signaling; RGS-R; A28-RGS14P Polyclonal 0.05 mg
15-288-21321 Regulator of G-protein signaling 16 - RGS16; Retinally abundant regulator of G-protein signaling; RGS-R; A28-RGS14P Polyclonal 0.1 mg
18-003-42464 Regulator of G-protein signaling 16 - RGS16; Retinally abundant regulator of G-protein signaling; RGS-R; A28-RGS14P Polyclonal 0.1 mg Protein A
EIAAB34546 A28-RGS14P,Homo sapiens,hRGS-r,Human,Regulator of G-protein signaling 16,Retinally abundant regulator of G-protein signaling,Retinal-specific RGS,RGS16,RGS16,RGSR,RGS-r
EIAAB34545 A28-RGS14P,Mouse,Mus musculus,Regulator of G-protein signaling 16,Retinally abundant regulator of G-protein signaling,Retinal-specific RGS,RGS16,Rgs16,Rgsr,RGS-r
EIAAB34543 Rat,Rattus norvegicus,Regulator of G-protein signaling 16,Retinally abundant regulator of G-protein signaling,Retinal-specific RGS,RGS16,Rgs16,Rgsr,RGS-r
EIAAB34544 Bos taurus,Bovine,Regulator of G-protein signaling 16,Retinally abundant regulator of G-protein signaling,Retinal-specific RGS,RGS16,RGS16,RGS-r
29-805 RGS18 is a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signaling activity of G-p 0.1 mg
201-20-4871 RGS20{regulator of G-protein signaling 20}rabbit.pAb 0.2ml
25-179 Members of the RGS (regulator of G protein signaling) family, such as RGS6, modulate G protein function by activating the intrinsic GTPase activity of the alpha (guanine nucleotide-binding) subunits.M 0.05 mg
RGS20 RGS20 Gene regulator of G-protein signaling 20
G7087 Regulator of G-protein signaling 20 (RGS20), Bovine, ELISA Kit 96T
G7088 Regulator of G-protein signaling 20 (RGS20), Chicken, ELISA Kit 96T
G7089 Regulator of G-protein signaling 20 (RGS20), Human, ELISA Kit 96T
G7090 Regulator of G-protein signaling 20 (RGS20), Mouse, ELISA Kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur