Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Replication-associated protein (EC 2.7.7.-) (EC 3.1.21.-) (EC 3.6.1.3) (ATP-dependent helicase Rep) (RepP)

 REP_PCV2                Reviewed;         314 AA.
Q8BB16; Q8BB13; Q8BB14; Q8BB15;
25-OCT-2005, integrated into UniProtKB/Swiss-Prot.
01-MAR-2003, sequence version 1.
05-JUL-2017, entry version 70.
RecName: Full=Replication-associated protein;
EC=2.7.7.-;
EC=3.1.21.-;
EC=3.6.1.3;
AltName: Full=ATP-dependent helicase Rep;
AltName: Full=RepP;
Name=Rep; ORFNames=ORF1;
Porcine circovirus 2 (PCV2).
Viruses; ssDNA viruses; Circoviridae; Circovirus.
NCBI_TaxID=85708;
NCBI_TaxID=9823; Sus scrofa (Pig).
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS REP; REP'; REP3A; REP3B
AND REP3C), AND ALTERNATIVE PROMOTER USAGE.
STRAIN=Isolate PCV/688;
PubMed=12504550; DOI=10.1006/viro.2002.1733;
Cheung A.K.;
"Transcriptional analysis of porcine circovirus type 2.";
Virology 305:168-180(2003).
[2]
FUNCTION, AND MUTAGENESIS OF 179-GLY-LYS-180.
STRAIN=Isolate PCV/688;
PubMed=12954212; DOI=10.1016/S0042-6822(03)00373-8;
Cheung A.K.;
"The essential and nonessential transcription units for viral protein
synthesis and DNA replication of porcine circovirus type 2.";
Virology 313:452-459(2003).
[3]
SUBCELLULAR LOCATION, AND NUCLEAR LOCALIZATION SIGNAL.
PubMed=19150331; DOI=10.1016/j.bbrc.2009.01.001;
Lin W.-L., Chien M.-S., Du Y.-W., Wu P.-C., Huang C.;
"The N-terminus of porcine circovirus type 2 replication protein is
required for nuclear localization and ori binding activities.";
Biochem. Biophys. Res. Commun. 379:1066-1071(2009).
[4]
STRUCTURE BY NMR OF 1-116, COFACTOR, AND CHARACTERIZATION.
PubMed=17275023; DOI=10.1016/j.jmb.2007.01.002;
Vega-Rocha S., Byeon I.-J.L., Gronenborn B., Gronenborn A.M.,
Campos-Olivas R.;
"Solution structure, divalent metal and DNA binding of the
endonuclease domain from the replication initiation protein from
porcine circovirus 2.";
J. Mol. Biol. 367:473-487(2007).
-!- FUNCTION: Essential for the replication of viral ssDNA. The closed
circular ssDNA genome is first converted to a superhelical dsDNA.
Rep and/or Rep' binds a specific hairpin at the genome origin of
replication. Introduces an endonucleolytic nick within the
conserved sequence 5'-AGTATTAC-3' in the intergenic region of the
genome, thereby initiating the rolling circle replication (RCR).
Following cleavage, binds covalently to the 5'-phosphate of DNA as
a tyrosyl ester. The cleavage gives rise to a free 3'-OH that
serves as a primer for the cellular DNA polymerase. The polymerase
synthesizes the (+) strand DNA by rolling circle mechanism. After
one round of replication, a Rep-catalyzed nucleotidyl transfer
reaction releases a circular single-stranded virus genome, thereby
terminating the replication. Displays origin-specific DNA
cleavage, nucleotidyl transferase, ATPase and helicase activities.
ATPase activity is probably carried by the isoform Rep (By
similarity). {ECO:0000250, ECO:0000269|PubMed:12954212}.
-!- CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
-!- COFACTOR:
Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
Evidence={ECO:0000305|PubMed:17275023};
Name=Mn(2+); Xref=ChEBI:CHEBI:29035;
Evidence={ECO:0000305|PubMed:17275023};
Note=Divalent metal cations, possibly Mg(2+) or Mn(2+).
{ECO:0000305|PubMed:17275023};
-!- SUBUNIT: Interacts with the capsid protein; this interaction
relocates Rep into the nucleus. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Host nucleus {ECO:0000305|PubMed:19150331}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative promoter usage, Alternative splicing; Named isoforms=10;
Name=Rep;
IsoId=Q8BB16-1; Sequence=Displayed;
Note=Produced by alternative promoter usage.;
Name=Rep';
IsoId=Q8BB16-2; Sequence=VSP_015884, VSP_015885;
Note=Produced by alternative splicing of isoform Rep.;
Name=NS462;
IsoId=Q8BB12-2; Sequence=External;
Name=NS642;
IsoId=Q8BB12-3; Sequence=External;
Name=NS0;
IsoId=Q8BB12-1; Sequence=External;
Note=Produced by alternative promoter usage.;
Name=NS515;
IsoId=Q8BB16-6; Sequence=Not described;
Note=Produced by alternative promoter usage.;
Name=NS672;
IsoId=Q8BB16-7; Sequence=Not described;
Note=Produced by alternative promoter usage.;
Name=Rep3a;
IsoId=Q8BB16-3; Sequence=VSP_015883;
Note=Produced by alternative splicing of isoform Rep.;
Name=Rep3b;
IsoId=Q8BB16-4; Sequence=VSP_015882;
Note=Produced by alternative splicing of isoform Rep.;
Name=Rep3c;
IsoId=Q8BB16-5; Sequence=Not described;
Note=Produced by alternative splicing of isoform Rep.;
-!- DOMAIN: There are 3 rolling circle replication (RCR) motifs. RCR-2
is probably involved in metal coordination. RCR-3 is required for
phosphodiester bond cleavage for initiation of RCR.
-!- SIMILARITY: Belongs to the nanoviruses/circoviruses replication-
associated protein family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY094619; AAM21844.1; -; Genomic_DNA.
EMBL; AY094619; AAM21845.1; -; Genomic_DNA.
EMBL; AY094619; AAM21846.1; -; Genomic_DNA.
EMBL; AY094619; AAM21847.1; -; Genomic_DNA.
PDB; 2HW0; NMR; -; A=2-116.
PDBsum; 2HW0; -.
ProteinModelPortal; Q8BB16; -.
SMR; Q8BB16; -.
OrthoDB; VOG090000BA; -.
EvolutionaryTrace; Q8BB16; -.
Proteomes; UP000000470; Genome.
GO; GO:0042025; C:host cell nucleus; IEA:UniProtKB-SubCell.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0042624; F:ATPase activity, uncoupled; IEA:InterPro.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0016888; F:endodeoxyribonuclease activity, producing 5'-phosphomonoesters; IEA:InterPro.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0016779; F:nucleotidyltransferase activity; IEA:UniProtKB-KW.
GO; GO:0003723; F:RNA binding; IEA:InterPro.
GO; GO:0003724; F:RNA helicase activity; IEA:InterPro.
GO; GO:0006260; P:DNA replication; IEA:UniProtKB-KW.
GO; GO:0018142; P:protein-DNA covalent cross-linking; IEA:InterPro.
GO; GO:0039684; P:rolling circle single-stranded viral DNA replication; IDA:UniProtKB.
InterPro; IPR000605; Helicase_SF3_ssDNA/RNA_vir.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR003365; Viral_rep_N.
Pfam; PF00910; RNA_helicase; 1.
Pfam; PF02407; Viral_Rep; 1.
SUPFAM; SSF52540; SSF52540; 1.
1: Evidence at protein level;
3D-structure; Alternative promoter usage; Alternative splicing;
ATP-binding; Complete proteome; Covalent protein-DNA linkage;
DNA replication; DNA-binding; Endonuclease; Helicase; Host nucleus;
Hydrolase; Metal-binding; Multifunctional enzyme; Nuclease;
Nucleotide-binding; Nucleotidyltransferase; Transferase.
CHAIN 1 314 Replication-associated protein.
/FTId=PRO_0000133089.
NP_BIND 174 181 ATP. {ECO:0000250}.
MOTIF 4 18 Nuclear localization signal.
{ECO:0000305|PubMed:19150331}.
MOTIF 19 22 RCR-1. {ECO:0000250}.
MOTIF 57 62 RCR-2. {ECO:0000250}.
MOTIF 96 99 RCR-3. {ECO:0000250}.
ACT_SITE 96 96 For DNA cleavage activity. {ECO:0000250}.
METAL 48 48 Divalent metal cation. {ECO:0000255}.
METAL 57 57 Divalent metal cation. {ECO:0000255}.
METAL 100 100 Divalent metal cation. {ECO:0000255}.
VAR_SEQ 16 254 Missing (in isoform Rep3b).
{ECO:0000305}.
/FTId=VSP_015882.
VAR_SEQ 16 249 Missing (in isoform Rep3a).
{ECO:0000305}.
/FTId=VSP_015883.
VAR_SEQ 123 178 VSTLLESGSLVTVAEQHPVTFVRNFRGLAELLKVSGKMQKR
DWKTNVHVIVGPPGC -> YSDYQQSDPVGMVLLNCCPSCR
SSLSEDYFLGILEECYRTIHGGRGPVRHPFPPMP (in
isoform Rep'). {ECO:0000305}.
/FTId=VSP_015884.
VAR_SEQ 179 314 Missing (in isoform Rep'). {ECO:0000305}.
/FTId=VSP_015885.
MUTAGEN 179 180 GK->DI: Complete loss of viral DNA
synthesis. {ECO:0000269|PubMed:12954212}.
STRAND 8 11 {ECO:0000244|PDB:2HW0}.
STRAND 17 23 {ECO:0000244|PDB:2HW0}.
HELIX 26 33 {ECO:0000244|PDB:2HW0}.
HELIX 37 39 {ECO:0000244|PDB:2HW0}.
STRAND 40 48 {ECO:0000244|PDB:2HW0}.
STRAND 57 66 {ECO:0000244|PDB:2HW0}.
HELIX 70 77 {ECO:0000244|PDB:2HW0}.
TURN 78 80 {ECO:0000244|PDB:2HW0}.
STRAND 81 84 {ECO:0000244|PDB:2HW0}.
HELIX 90 98 {ECO:0000244|PDB:2HW0}.
STRAND 103 108 {ECO:0000244|PDB:2HW0}.
SEQUENCE 314 AA; 35762 MW; 3FE9D85F2CD656FC CRC64;
MPSKKNGRSG PQPHKRWVFT LNNPSEDERK KIREPPISLF DYFIVGEEGN EEGRTPHLQG
FANFVKKQTF NKVKWYLGAR CHIEKAKGTD QQNKEYCSKE GNLLIECGAP RSQGQRSDLS
TAVSTLLESG SLVTVAEQHP VTFVRNFRGL AELLKVSGKM QKRDWKTNVH VIVGPPGCGK
SKWAANFADP ETTYWKPPRN KWWDGYHGEE VVVIDDFYGW LPWDDLLRLC DRYPLTVETK
GGTVPFLARS ILITSNQTPL EWYSSTAVPA VEALYRRITS LVFWKNATEQ STEEGGQFVT
LSPPCPEFPY EINY


Related products :

Catalog number Product name Quantity
EIAAB11501 DNA replication ATP-dependent helicase-like homolog,DNA2,DNA2L,DNA2-like helicase,Homo sapiens,Human,KIAA0083
EIAAB11503 DNA replication ATP-dependent helicase-like homolog,Dna2,Dna2l,DNA2-like helicase,Kiaa0083,Mouse,Mus musculus
EIAAB11502 Chicken,DNA replication ATP-dependent helicase-like homolog,DNA2,DNA2L,DNA2-like helicase,Gallus gallus,RCJMB04_11a16
DNA2_BOVIN Bovine ELISA Kit FOR DNA replication ATP-dependent helicase per nuclease DNA2 96T
18-003-44036 Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 - EC 3.6.1.-; DEAH-box protein 16; ATP-dependent RNA helicase _3 Polyclonal 0.05 mg Aff Pur
18-003-42773 Probable ATP-dependent RNA helicase DDX6 - EC 3.6.1.-; DEAD box protein 6; ATP-dependent RNA helicase p54; Oncogene RCK Polyclonal 0.1 mg Protein A
EIAAB10817 ATP-dependent RNA helicase DDX54,ATP-dependent RNA helicase DP97,DDX54,DEAD box protein 54,DEAD box RNA helicase 97 kDa,Homo sapiens,Human
EIAAB11209 ATP-dependent RNA helicase _46,DBP1,DDX15,DEAH box protein 15,DHX15,Homo sapiens,Human,Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
EIAAB10823 ATP-dependent 61 kDa nucleolar RNA helicase,D11Ertd619e,Ddx56,DEAD box protein 56,Mouse,Mus musculus,Noh61,Probable ATP-dependent RNA helicase DDX56
EIAAB10831 ATP-dependent RNA helicase p54,DDX6,DEAD box protein 6,HLR2,Homo sapiens,Human,Oncogene RCK,Probable ATP-dependent RNA helicase DDX6,RCK
EIAAB10832 ATP-dependent RNA helicase p54,Ddx6,DEAD box protein 6,Hlr2,Mouse,Mus musculus,Oncogene RCK homolog,Probable ATP-dependent RNA helicase DDX6,Rck
EIAAB11211 ATP-dependent RNA helicase _3,DBP2,DDX16,DEAH-box protein 16,DHX16,Homo sapiens,Human,KIAA0577,Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
EIAAB07136 ATP-dependent helicase CHD3,CHD3,CHD-3,Chromodomain-helicase-DNA-binding protein 3,Homo sapiens,Human,hZFH,Mi-2 autoantigen 240 kDa protein,Mi2-alpha,Zinc finger helicase
EIAAB46583 ATP-dependent DNA helicase 2 subunit 2,ATP-dependent DNA helicase II 80 kDa subunit,CTC box-binding factor 85 kDa subunit,CTC85,CTCBF,DNA repair protein XRCC5,G22p2,Ku autoantigen protein p86 homolog,
EIAAB10794 ATP-dependent RNA helicase DDX42,DDX42,DEAD box protein 42,Homo sapiens,Human,RHELP,RNA helicase-like protein,RNA helicase-related protein,RNAHP,SF3b DEAD box protein,SF3b125,Splicing factor 3B-associ
EIAAB10824 ATP-dependent 61 kDa nucleolar RNA helicase,DDX21,DDX56,DEAD box protein 21,DEAD box protein 56,Homo sapiens,Human,NOH61,Probable ATP-dependent RNA helicase DDX56
EIAAB07145 ATP-dependent helicase CHD8,CHD8,CHD-8,Chromodomain-helicase-DNA-binding protein 8,Helicase with SNF2 domain 1,HELSNF1,Homo sapiens,Human,KIAA1564
EIAAB32475 ATP-dependent RNA helicase DHX38,DDX38,DEAH box protein 38,DHX38,Homo sapiens,Human,KIAA0224,Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16,PRP16
EIAAB46584 86 kDa subunit of Ku antigen,ATP-dependent DNA helicase 2 subunit 2,ATP-dependent DNA helicase II 80 kDa subunit,CTC box-binding factor 85 kDa subunit,CTC85,CTCBF,DNA repair protein XRCC5,G22P2,Homo s
EIAAB34186 ATP-dependent DNA helicase Q1,DNA helicase, RecQ-like type 1,DNA-dependent ATPase Q1,Homo sapiens,Human,RecQ protein-like 1,RecQ1,RECQ1,RECQL,RECQL1
EIAAB10813 ATP-dependent RNA helicase ROK1-like,DDX52,DEAD box protein 52,Homo sapiens,Human,HUSSY-19,Probable ATP-dependent RNA helicase DDX52,ROK1
EIAAB32476 ATP-dependent RNA helicase DHX38,Bos taurus,Bovine,DEAH box protein 38,DHX38,Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16,PRP16
25-214 SMARCAD1 belongs to the SNF2_RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase. 0.05 mg
18-003-42774 Spliceosome RNA helicase BAT1 - EC 3.6.1.-; DEAD box protein UAP56; 56 kDa U2AF65-associated protein; ATP-dependent RNA helicase p47; HLA-B-associated transcript-1 Polyclonal 0.05 mg Aff Pur
EIAAB10814 ATP-dependent RNA helicase ROK1-like,Ddx52,DEAD box protein 52,Probable ATP-dependent RNA helicase DDX52,Rat,Rattus norvegicus,Rok1,rROK1L


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur