Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

S-phase kinase-associated protein 2 (Cyclin-A/CDK2-associated protein p45) (F-box protein Skp2) (F-box/LRR-repeat protein 1) (p45skp2)

 SKP2_HUMAN              Reviewed;         424 AA.
Q13309; A8K5E0; B4DJT4; Q8TDZ0; Q8TDZ1; Q9BV69;
03-OCT-2003, integrated into UniProtKB/Swiss-Prot.
03-OCT-2003, sequence version 2.
20-JUN-2018, entry version 187.
RecName: Full=S-phase kinase-associated protein 2;
AltName: Full=Cyclin-A/CDK2-associated protein p45;
AltName: Full=F-box protein Skp2;
AltName: Full=F-box/LRR-repeat protein 1;
AltName: Full=p45skp2;
Name=SKP2; Synonyms=FBXL1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PROTEIN SEQUENCE OF 6-19;
31-58; 80-86 AND 365-372, AND INTERACTION WITH CYCLIN A-CDK2 COMPLEX.
PubMed=7553852; DOI=10.1016/0092-8674(95)90271-6;
Zhang H., Kobayashi R., Galaktionov K., Beach D.;
"p19Skp1 and p45Skp2 are essential elements of the cyclin A-CDK2 S
phase kinase.";
Cell 82:915-925(1995).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
TISSUE=Liver;
Yamaguchi T.;
"Human SKP2-like protein.";
Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Prostatic carcinoma;
Kokontis J.M., Fukuchi J., Liao S.;
"Androgenic regulation of Skp2 in androgen-dependent and -independent
LNCaP human prostate tumor cells.";
Submitted (APR-2001) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Thalamus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15372022; DOI=10.1038/nature02919;
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S.,
Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M.,
She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.,
Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M.,
Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T.,
Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M.,
Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K.,
Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C.,
Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M.,
Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A.,
Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M.,
Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M.,
Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S.,
Richardson P., Lucas S.M., Myers R.M., Rubin E.M.;
"The DNA sequence and comparative analysis of human chromosome 5.";
Nature 431:268-274(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
INTERACTION WITH RBL2, AND FUNCTION IN UBIQUITINATION OF RBL2.
PubMed=12435635; DOI=10.1101/gad.1011202;
Tedesco D., Lukas J., Reed S.I.;
"The pRb-related protein p130 is regulated by phosphorylation-
dependent proteolysis via the protein-ubiquitin ligase SCF(Skp2).";
Genes Dev. 16:2946-2957(2002).
[9]
INTERACTION WITH ORC1, AND FUNCTION IN UBIQUITINATION OF ORC1.
PubMed=11931757; DOI=10.1016/S1097-2765(02)00467-7;
Mendez J., Zou-Yang X.H., Kim S.Y., Hidaka M., Tansey W.P.,
Stillman B.;
"Human origin recognition complex large subunit is degraded by
ubiquitin-mediated proteolysis after initiation of DNA replication.";
Mol. Cell 9:481-491(2002).
[10]
INTERACTION WITH CDT1, AND FUNCTION IN UBIQUITINATION OF CDT1.
PubMed=12840033; DOI=10.1074/jbc.C300251200;
Li X., Zhao Q., Liao R., Sun P., Wu X.;
"The SCF(Skp2) ubiquitin ligase complex interacts with the human
replication licensing factor Cdt1 and regulates Cdt1 degradation.";
J. Biol. Chem. 278:30854-30858(2003).
[11]
INTERACTION WITH MYC, AND FUNCTION IN UBIQUITINATION OF MYC.
PubMed=12769844; DOI=10.1016/S1097-2765(03)00193-X;
von der Lehr N., Johansson S., Wu S., Bahram F., Castell A.,
Cetinkaya C., Hydbring P., Weidung I., Nakayama K., Nakayama K.I.,
Soderberg O., Kerppola T.K., Larsson L.G.;
"The F-box protein Skp2 participates in c-Myc proteosomal degradation
and acts as a cofactor for c-Myc-regulated transcription.";
Mol. Cell 11:1189-1200(2003).
[12]
INTERACTION WITH UBP43, AND FUNCTION IN UBIQUITINATION OF UBP43.
PubMed=15342634; DOI=10.1074/jbc.M403189200;
Tokarz S., Berset C., La Rue J., Friedman K., Nakayama K.,
Nakayama K., Zhang D.E., Lanker S.;
"The ISG15 isopeptidase UBP43 is regulated by proteolysis via the
SCFSkp2 ubiquitin ligase.";
J. Biol. Chem. 279:46424-46430(2004).
[13]
FUNCTION IN UBIQUITINATION OF CDKN1A.
PubMed=16262255; DOI=10.1021/bi051071j;
Wang W., Nacusi L., Sheaff R.J., Liu X.;
"Ubiquitination of p21Cip1/WAF1 by SCFSkp2: substrate requirement and
ubiquitination site selection.";
Biochemistry 44:14553-14564(2005).
[14]
INTERACTION WITH RAG2, AND FUNCTION IN UBIQUITINATION OF RAG2.
PubMed=15949444; DOI=10.1016/j.molcel.2005.05.011;
Jiang H., Chang F.C., Ross A.E., Lee J., Nakayama K., Nakayama K.,
Desiderio S.;
"Ubiquitylation of RAG-2 by Skp2-SCF links destruction of the V(D)J
recombinase to the cell cycle.";
Mol. Cell 18:699-709(2005).
[15]
FUNCTION IN UBIQUITINATION OF CDK9.
PubMed=16103164; DOI=10.1128/JVI.79.17.11135-11141.2005;
Barboric M., Zhang F., Besenicar M., Plemenitas A., Peterlin B.M.;
"Ubiquitylation of Cdk9 by Skp2 facilitates optimal Tat
transactivation.";
J. Virol. 79:11135-11141(2005).
[16]
INTERACTION WITH FOXO1, AND FUNCTION IN UBIQUITINATION OF FOXO1.
PubMed=15668399; DOI=10.1073/pnas.0406789102;
Huang H., Regan K.M., Wang F., Wang D., Smith D.I., van Deursen J.M.,
Tindall D.J.;
"Skp2 inhibits FOXO1 in tumor suppression through ubiquitin-mediated
degradation.";
Proc. Natl. Acad. Sci. U.S.A. 102:1649-1654(2005).
[17]
INTERACTION WITH TOB1, AND FUNCTION IN UBIQUITINATION OF TOB1.
PubMed=16951159; DOI=10.1158/0008-5472.CAN-06-1603;
Hiramatsu Y., Kitagawa K., Suzuki T., Uchida C., Hattori T.,
Kikuchi H., Oda T., Hatakeyama S., Nakayama K.I., Yamamoto T.,
Konno H., Kitagawa M.;
"Degradation of Tob1 mediated by SCFSkp2-dependent ubiquitination.";
Cancer Res. 66:8477-8483(2006).
[18]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=17081983; DOI=10.1016/j.cell.2006.09.026;
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,
Mann M.;
"Global, in vivo, and site-specific phosphorylation dynamics in
signaling networks.";
Cell 127:635-648(2006).
[19]
INTERACTION WITH ELF4, AND FUNCTION IN UBIQUITINATION OF ELF4.
PubMed=16581786; DOI=10.1128/MCB.26.8.3114-3123.2006;
Liu Y., Hedvat C.V., Mao S., Zhu X.H., Yao J., Nguyen H., Koff A.,
Nimer S.D.;
"The ETS protein MEF is regulated by phosphorylation-dependent
proteolysis via the protein-ubiquitin ligase SCFSkp2.";
Mol. Cell. Biol. 26:3114-3123(2006).
[20]
INTERACTION WITH THE SCF(SKP2)-LIKE COMPLEX, AND INTERACTION WITH
TRIM21.
PubMed=16880511; DOI=10.1128/MCB.01630-05;
Sabile A., Meyer A.M., Wirbelauer C., Hess D., Kogel U., Scheffner M.,
Krek W.;
"Regulation of p27 degradation and S-phase progression by Ro52 RING
finger protein.";
Mol. Cell. Biol. 26:5994-6004(2006).
[21]
INTERACTION WITH KMT2A/MLL1, AND FUNCTION IN UBIQUITINATION OF
KMT2A/MLL1.
PubMed=17908926; DOI=10.1101/gad.1574507;
Liu H., Cheng E.H., Hsieh J.J.;
"Bimodal degradation of MLL by SCFSkp2 and APCCdc20 assures cell cycle
execution: a critical regulatory circuit lost in leukemogenic MLL
fusions.";
Genes Dev. 21:2385-2398(2007).
[22]
INTERACTION WITH TAL1, AND FUNCTION IN UBIQUITINATION OF TAL1.
PubMed=17962192; DOI=10.1074/jbc.M704981200;
Nie L., Wu H., Sun X.H.;
"Ubiquitination and degradation of Tal1/SCL are induced by Notch
signaling and depend on Skp2 and CHIP.";
J. Biol. Chem. 283:684-692(2008).
[23]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-179, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18220336; DOI=10.1021/pr0705441;
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,
Yates J.R. III;
"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for
efficient phosphoproteomic analysis.";
J. Proteome Res. 7:1346-1351(2008).
[24]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18691976; DOI=10.1016/j.molcel.2008.07.007;
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,
Greff Z., Keri G., Stemmann O., Mann M.;
"Kinase-selective enrichment enables quantitative phosphoproteomics of
the kinome across the cell cycle.";
Mol. Cell 31:438-448(2008).
[25]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[26]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[27]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[28]
DEUBIQUITINATION BY USP13.
PubMed=21571647; DOI=10.1073/pnas.1100028108;
Chen M., Gutierrez G.J., Ronai Z.A.;
"Ubiquitin-recognition protein Ufd1 couples the endoplasmic reticulum
(ER) stress response to cell cycle control.";
Proc. Natl. Acad. Sci. U.S.A. 108:9119-9124(2011).
[29]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[30]
FUNCTION, ACETYLATION AT LYS-68 AND LYS-71, NUCLEAR LOCALIZATION
SIGNAL, AND SUBCELLULAR LOCATION.
PubMed=22770219; DOI=10.1016/j.cell.2012.05.038;
Inuzuka H., Gao D., Finley L.W., Yang W., Wan L., Fukushima H.,
Chin Y.R., Zhai B., Shaik S., Lau A.W., Wang Z., Gygi S.P.,
Nakayama K., Teruya-Feldstein J., Toker A., Haigis M.C.,
Pandolfi P.P., Wei W.;
"Acetylation-dependent regulation of Skp2 function.";
Cell 150:179-193(2012).
[31]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-64; SER-72; SER-75 AND
SER-179, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[32]
X-RAY CRYSTALLOGRAPHY (1.8 ANGSTROMS) OF 89-424 IN COMPLEX WITH 1-147
OF SKP1, AND LEUCINE-RICH REPEATS.
PubMed=11099048; DOI=10.1038/35042620;
Schulman B.A., Carrano A.C., Jeffrey P.D., Bowen Z., Kinnucan E.R.E.,
Finnin M.S., Elledge S.J., Harper J.W., Pagano M., Pavletich N.P.;
"Insights into SCF ubiquitin ligases from the structure of the Skp1-
Skp2 complex.";
Nature 408:381-386(2000).
[33]
X-RAY CRYSTALLOGRAPHY (3.1 ANGSTROMS) OF 97-137 IN COMPLEX WITH CUL1;
SKP1 AND RBX1, AND INTERACTION WITH CKS1.
PubMed=11961546; DOI=10.1038/416703a;
Zheng N., Schulman B.A., Song L., Miller J.J., Jeffrey P.D., Wang P.,
Chu C., Koepp D.M., Elledge S.J., Pagano M., Conaway R.C.,
Conaway J.W., Harper J.W., Pavletich N.P.;
"Structure of the Cul1-Rbx1-Skp1-F box Skp2 SCF ubiquitin ligase
complex.";
Nature 416:703-709(2002).
-!- FUNCTION: Substrate recognition component of a SCF (SKP1-CUL1-F-
box protein) E3 ubiquitin-protein ligase complex which mediates
the ubiquitination and subsequent proteasomal degradation of
target proteins involved in cell cycle progression, signal
transduction and transcription. Specifically recognizes
phosphorylated CDKN1B/p27kip and is involved in regulation of G1/S
transition. Degradation of CDKN1B/p27kip also requires CKS1.
Recognizes target proteins ORC1, CDT1, RBL2, KMT2A/MLL1, CDK9,
RAG2, FOXO1, UBP43, and probably MYC, TOB1 and TAL1. Degradation
of TAL1 also requires STUB1. Recognizes CDKN1A in association with
CCNE1 or CCNE2 and CDK2. Promotes ubiquitination and destruction
of CDH1 in a CK1-Dependent Manner, thereby regulating cell
migration. {ECO:0000269|PubMed:11931757,
ECO:0000269|PubMed:12435635, ECO:0000269|PubMed:12769844,
ECO:0000269|PubMed:12840033, ECO:0000269|PubMed:15342634,
ECO:0000269|PubMed:15668399, ECO:0000269|PubMed:15949444,
ECO:0000269|PubMed:16103164, ECO:0000269|PubMed:16262255,
ECO:0000269|PubMed:16581786, ECO:0000269|PubMed:16951159,
ECO:0000269|PubMed:17908926, ECO:0000269|PubMed:17962192,
ECO:0000269|PubMed:22770219}.
-!- PATHWAY: Protein modification; protein ubiquitination.
-!- SUBUNIT: Part of a SCF(SKP2) complex consisting of CUL1, RBX1,
SKP1 and SKP2. Component of a SCF(SKP2)-like complex containing
CUL1, SKP1, TRIM21 and SKP2. Interacts directly with CUL1 and
SKP1. Interacts with CKS1. Interacts with the cyclin-A-CDK2
complex. Interacts with ORC1, phosphorylated CDT1, phosphorylated
RBL2, ELF4, phosphorylated RAG2, FOXO1, UBP43, MYC, TOB1, TAL1 and
KMT2A/MLL1. Interacts with TRIM21. {ECO:0000269|PubMed:11099048,
ECO:0000269|PubMed:11931757, ECO:0000269|PubMed:11961546,
ECO:0000269|PubMed:12435635, ECO:0000269|PubMed:12769844,
ECO:0000269|PubMed:12840033, ECO:0000269|PubMed:15342634,
ECO:0000269|PubMed:15668399, ECO:0000269|PubMed:15949444,
ECO:0000269|PubMed:16581786, ECO:0000269|PubMed:16880511,
ECO:0000269|PubMed:16951159, ECO:0000269|PubMed:17908926,
ECO:0000269|PubMed:17962192, ECO:0000269|PubMed:7553852}.
-!- INTERACTION:
Self; NbExp=3; IntAct=EBI-456291, EBI-456291;
A5D8W4:CDH1; NbExp=2; IntAct=EBI-456291, EBI-7793316;
P09803:Cdh1 (xeno); NbExp=2; IntAct=EBI-456291, EBI-984420;
P38936:CDKN1A; NbExp=2; IntAct=EBI-456291, EBI-375077;
P46527:CDKN1B; NbExp=4; IntAct=EBI-456291, EBI-519280;
P61024:CKS1B; NbExp=6; IntAct=EBI-456291, EBI-456371;
Q13616:CUL1; NbExp=8; IntAct=EBI-456291, EBI-359390;
P28562:DUSP1; NbExp=3; IntAct=EBI-456291, EBI-975493;
Q09472:EP300; NbExp=3; IntAct=EBI-456291, EBI-447295;
Q9UM11:FZR1; NbExp=2; IntAct=EBI-456291, EBI-724997;
Q03164:KMT2A; NbExp=2; IntAct=EBI-15490084, EBI-591370;
P01106:MYC; NbExp=2; IntAct=EBI-456291, EBI-447544;
Q13415:ORC1; NbExp=2; IntAct=EBI-456291, EBI-374847;
P35232:PHB; NbExp=2; IntAct=EBI-7791408, EBI-354213;
P62877:RBX1; NbExp=3; IntAct=EBI-456291, EBI-398523;
Q9NTG7:SIRT3; NbExp=5; IntAct=EBI-456291, EBI-724621;
P63208:SKP1; NbExp=13; IntAct=EBI-456291, EBI-307486;
P63208-1:SKP1; NbExp=7; IntAct=EBI-15490084, EBI-307497;
Q4AE16:X (xeno); NbExp=3; IntAct=EBI-456291, EBI-7418293;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:22770219}.
Nucleus {ECO:0000269|PubMed:22770219}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=SKP2-alpha;
IsoId=Q13309-1; Sequence=Displayed;
Name=2; Synonyms=SKP2-beta;
IsoId=Q13309-2; Sequence=VSP_008432;
Name=3;
IsoId=Q13309-4; Sequence=VSP_044931, VSP_044932;
Note=No experimental confirmation available.;
-!- PTM: Ubiquitinated by the APC/C complex, leading to its
degradation by the proteasome. Deubiquitinated by USP13.
{ECO:0000269|PubMed:21571647}.
-!- PTM: Acetylation at Lys-68 and Lys-71 increases stability through
impairment of APC/C-mediated proteolysis and promotes cytoplasmic
retention. Deacetylated by SIRT3. {ECO:0000269|PubMed:22770219}.
-!- SEQUENCE CAUTION:
Sequence=AAC50242.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Sequence=BAB87202.1; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; U33761; AAC50242.1; ALT_INIT; mRNA.
EMBL; AB050979; BAB87200.1; -; mRNA.
EMBL; AB050980; BAB87201.1; -; mRNA.
EMBL; AB050981; BAB87202.1; ALT_SEQ; mRNA.
EMBL; AY029177; AAK31593.1; -; mRNA.
EMBL; AK291255; BAF83944.1; -; mRNA.
EMBL; AK296223; BAG58946.1; -; mRNA.
EMBL; AC008942; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471119; EAW55936.1; -; Genomic_DNA.
EMBL; BC001441; AAH01441.1; -; mRNA.
EMBL; BC007441; AAH07441.1; -; mRNA.
CCDS; CCDS3915.1; -. [Q13309-2]
CCDS; CCDS3916.1; -. [Q13309-1]
CCDS; CCDS58944.1; -. [Q13309-4]
PIR; I39171; I39171.
RefSeq; NP_001230049.1; NM_001243120.1. [Q13309-4]
RefSeq; NP_005974.2; NM_005983.3. [Q13309-1]
RefSeq; NP_116026.1; NM_032637.3. [Q13309-2]
UniGene; Hs.23348; -.
PDB; 1FQV; X-ray; 2.80 A; A/C/E/G/I/K/M/O=89-424.
PDB; 1FS1; X-ray; 1.80 A; A/C=89-141.
PDB; 1FS2; X-ray; 2.90 A; A/C=89-398.
PDB; 1LDK; X-ray; 3.10 A; E=97-137.
PDB; 2ASS; X-ray; 3.00 A; B=89-424.
PDB; 2AST; X-ray; 2.30 A; B=89-424.
PDBsum; 1FQV; -.
PDBsum; 1FS1; -.
PDBsum; 1FS2; -.
PDBsum; 1LDK; -.
PDBsum; 2ASS; -.
PDBsum; 2AST; -.
ProteinModelPortal; Q13309; -.
SMR; Q13309; -.
BioGrid; 112393; 181.
CORUM; Q13309; -.
DIP; DIP-17011N; -.
IntAct; Q13309; 55.
MINT; Q13309; -.
STRING; 9606.ENSP00000274255; -.
iPTMnet; Q13309; -.
PhosphoSitePlus; Q13309; -.
BioMuta; SKP2; -.
DMDM; 37537922; -.
EPD; Q13309; -.
MaxQB; Q13309; -.
PaxDb; Q13309; -.
PeptideAtlas; Q13309; -.
PRIDE; Q13309; -.
ProteomicsDB; 59298; -.
ProteomicsDB; 59299; -. [Q13309-2]
TopDownProteomics; Q13309-1; -. [Q13309-1]
DNASU; 6502; -.
Ensembl; ENST00000274254; ENSP00000274254; ENSG00000145604. [Q13309-2]
Ensembl; ENST00000274255; ENSP00000274255; ENSG00000145604. [Q13309-1]
Ensembl; ENST00000620197; ENSP00000478031; ENSG00000145604. [Q13309-4]
GeneID; 6502; -.
KEGG; hsa:6502; -.
UCSC; uc003jkc.3; human. [Q13309-1]
CTD; 6502; -.
DisGeNET; 6502; -.
EuPathDB; HostDB:ENSG00000145604.15; -.
GeneCards; SKP2; -.
HGNC; HGNC:10901; SKP2.
HPA; CAB013491; -.
HPA; CAB013533; -.
HPA; HPA051196; -.
HPA; HPA054633; -.
MIM; 601436; gene.
neXtProt; NX_Q13309; -.
OpenTargets; ENSG00000145604; -.
PharmGKB; PA35801; -.
eggNOG; KOG2120; Eukaryota.
eggNOG; ENOG410Z2W2; LUCA.
GeneTree; ENSGT00390000007918; -.
HOGENOM; HOG000247037; -.
HOVERGEN; HBG047488; -.
InParanoid; Q13309; -.
KO; K03875; -.
OMA; EIWGIRC; -.
PhylomeDB; Q13309; -.
TreeFam; TF352582; -.
BioCyc; MetaCyc:ENSG00000145604-MONOMER; -.
Reactome; R-HSA-174178; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
Reactome; R-HSA-187577; SCF(Skp2)-mediated degradation of p27/p21.
Reactome; R-HSA-5689880; Ub-specific processing proteases.
Reactome; R-HSA-68949; Orc1 removal from chromatin.
Reactome; R-HSA-69231; Cyclin D associated events in G1.
Reactome; R-HSA-8939902; Regulation of RUNX2 expression and activity.
Reactome; R-HSA-8951664; Neddylation.
Reactome; R-HSA-983168; Antigen processing: Ubiquitination & Proteasome degradation.
SIGNOR; Q13309; -.
UniPathway; UPA00143; -.
ChiTaRS; SKP2; human.
EvolutionaryTrace; Q13309; -.
GeneWiki; SKP2; -.
GenomeRNAi; 6502; -.
PRO; PR:Q13309; -.
Proteomes; UP000005640; Chromosome 5.
Bgee; ENSG00000145604; -.
CleanEx; HS_SKP2; -.
ExpressionAtlas; Q13309; baseline and differential.
Genevisible; Q13309; HS.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0005730; C:nucleolus; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:HPA.
GO; GO:0019005; C:SCF ubiquitin ligase complex; IDA:UniProtKB.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0061630; F:ubiquitin protein ligase activity; IEA:Ensembl.
GO; GO:0004842; F:ubiquitin-protein transferase activity; EXP:Reactome.
GO; GO:0008283; P:cell proliferation; TAS:ProtInc.
GO; GO:0071460; P:cellular response to cell-matrix adhesion; IEA:Ensembl.
GO; GO:0000082; P:G1/S transition of mitotic cell cycle; TAS:ProtInc.
GO; GO:0000086; P:G2/M transition of mitotic cell cycle; IEA:Ensembl.
GO; GO:0033148; P:positive regulation of intracellular estrogen receptor signaling pathway; IEA:Ensembl.
GO; GO:1902916; P:positive regulation of protein polyubiquitination; IEA:Ensembl.
GO; GO:0048661; P:positive regulation of smooth muscle cell proliferation; IEA:Ensembl.
GO; GO:0043687; P:post-translational protein modification; TAS:Reactome.
GO; GO:0016579; P:protein deubiquitination; TAS:Reactome.
GO; GO:0000209; P:protein polyubiquitination; TAS:Reactome.
GO; GO:0042981; P:regulation of apoptotic process; IDA:MGI.
GO; GO:0051726; P:regulation of cell cycle; IEA:Ensembl.
GO; GO:0006511; P:ubiquitin-dependent protein catabolic process; IEA:Ensembl.
Gene3D; 3.80.10.10; -; 1.
InterPro; IPR036047; F-box-like_dom_sf.
InterPro; IPR001810; F-box_dom.
InterPro; IPR006553; Leu-rich_rpt_Cys-con_subtyp.
InterPro; IPR032675; LRR_dom_sf.
Pfam; PF12937; F-box-like; 1.
SMART; SM00256; FBOX; 1.
SMART; SM00367; LRR_CC; 5.
SUPFAM; SSF81383; SSF81383; 1.
PROSITE; PS50181; FBOX; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Complete proteome;
Cytoplasm; Direct protein sequencing; Leucine-rich repeat; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; Repeat;
Ubl conjugation; Ubl conjugation pathway.
CHAIN 1 424 S-phase kinase-associated protein 2.
/FTId=PRO_0000119954.
DOMAIN 94 140 F-box. {ECO:0000255|PROSITE-
ProRule:PRU00080}.
REPEAT 151 176 LRR 1. {ECO:0000269|PubMed:11099048}.
REPEAT 177 204 LRR 2. {ECO:0000269|PubMed:11099048}.
REPEAT 210 234 LRR 3. {ECO:0000269|PubMed:11099048}.
REPEAT 235 257 LRR 4. {ECO:0000269|PubMed:11099048}.
REPEAT 258 284 LRR 5. {ECO:0000269|PubMed:11099048}.
REPEAT 286 308 LRR 6. {ECO:0000269|PubMed:11099048}.
REPEAT 309 330 LRR 7. {ECO:0000269|PubMed:11099048}.
REPEAT 334 356 LRR 8. {ECO:0000269|PubMed:11099048}.
REPEAT 359 378 LRR 9. {ECO:0000269|PubMed:11099048}.
REPEAT 380 401 LRR 10. {ECO:0000269|PubMed:11099048}.
MOTIF 67 73 Nuclear localization signal.
{ECO:0000269|PubMed:22770219}.
MOD_RES 64 64 Phosphoserine.
{ECO:0000244|PubMed:17081983,
ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:18691976,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 68 68 N6-acetyllysine; by p300/EP300.
{ECO:0000269|PubMed:22770219}.
MOD_RES 71 71 N6-acetyllysine; by p300/EP300.
{ECO:0000269|PubMed:22770219}.
MOD_RES 72 72 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 75 75 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 179 179 Phosphoserine.
{ECO:0000244|PubMed:18220336,
ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 169 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044931.
VAR_SEQ 180 224 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_044932.
VAR_SEQ 355 424 ELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTT
IARPTIGNKKNQEIWGIKCRLTLQKPSCL -> LVTRAGVR
IRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYF
YRLVLKQ (in isoform 2).
{ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.2}.
/FTId=VSP_008432.
VARIANT 85 85 P -> L (in dbSNP:rs3913486).
/FTId=VAR_016984.
VARIANT 87 87 L -> I (in dbSNP:rs3913487).
/FTId=VAR_016985.
CONFLICT 185 185 H -> D (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 215 215 Missing (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 238 238 S -> P (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 241 241 S -> P (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 244 247 SEFA -> PKFP (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 251 251 L -> F (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 256 256 S -> P (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 268 268 D -> N (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 285 285 I -> M (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 319 319 D -> N (in Ref. 1; AAC50242).
{ECO:0000305}.
CONFLICT 332 332 F -> S (in Ref. 1; AAC50242).
{ECO:0000305}.
STRAND 97 100 {ECO:0000244|PDB:2AST}.
HELIX 102 109 {ECO:0000244|PDB:1FS1}.
HELIX 114 116 {ECO:0000244|PDB:1FS1}.
HELIX 117 121 {ECO:0000244|PDB:1FS1}.
HELIX 125 131 {ECO:0000244|PDB:1FS1}.
HELIX 134 136 {ECO:0000244|PDB:1FS1}.
STRAND 137 141 {ECO:0000244|PDB:2AST}.
HELIX 149 157 {ECO:0000244|PDB:2AST}.
STRAND 161 164 {ECO:0000244|PDB:2AST}.
STRAND 180 182 {ECO:0000244|PDB:1FS2}.
STRAND 185 187 {ECO:0000244|PDB:2AST}.
HELIX 195 202 {ECO:0000244|PDB:2AST}.
STRAND 209 212 {ECO:0000244|PDB:2AST}.
HELIX 220 226 {ECO:0000244|PDB:2AST}.
STRAND 233 236 {ECO:0000244|PDB:2AST}.
HELIX 245 254 {ECO:0000244|PDB:2AST}.
STRAND 260 262 {ECO:0000244|PDB:2AST}.
HELIX 271 280 {ECO:0000244|PDB:2AST}.
STRAND 287 289 {ECO:0000244|PDB:2AST}.
HELIX 294 296 {ECO:0000244|PDB:2AST}.
HELIX 299 308 {ECO:0000244|PDB:2AST}.
STRAND 313 316 {ECO:0000244|PDB:2AST}.
HELIX 325 333 {ECO:0000244|PDB:2AST}.
STRAND 339 341 {ECO:0000244|PDB:2AST}.
HELIX 350 358 {ECO:0000244|PDB:2AST}.
STRAND 364 366 {ECO:0000244|PDB:2AST}.
HELIX 376 382 {ECO:0000244|PDB:2AST}.
STRAND 386 389 {ECO:0000244|PDB:2AST}.
STRAND 402 404 {ECO:0000244|PDB:1FQV}.
STRAND 415 417 {ECO:0000244|PDB:2AST}.
SEQUENCE 424 AA; 47761 MW; F29B7C338A7A37E9 CRC64;
MHRKHLQEIP DLSSNVATSF TWGWDSSKTS ELLSGMGVSA LEKEEPDSEN IPQELLSNLG
HPESPPRKRL KSKGSDKDFV IVRRPKLNRE NFPGVSWDSL PDELLLGIFS CLCLPELLKV
SGVCKRWYRL ASDESLWQTL DLTGKNLHPD VTGRLLSQGV IAFRCPRSFM DQPLAEHFSP
FRVQHMDLSN SVIEVSTLHG ILSQCSKLQN LSLEGLRLSD PIVNTLAKNS NLVRLNLSGC
SGFSEFALQT LLSSCSRLDE LNLSWCFDFT EKHVQVAVAH VSETITQLNL SGYRKNLQKS
DLSTLVRRCP NLVHLDLSDS VMLKNDCFQE FFQLNYLQHL SLSRCYDIIP ETLLELGEIP
TLKTLQVFGI VPDGTLQLLK EALPHLQINC SHFTTIARPT IGNKKNQEIW GIKCRLTLQK
PSCL


Related products :

Catalog number Product name Quantity
EIAAB38589 Cyclin-A_CDK2-associated protein p45,F-box protein Skp2,F-box_LRR-repeat protein 1,FBXL1,Homo sapiens,Human,p45skp2,SKP2,S-phase kinase-associated protein 2
EIAAB38588 Cyclin-A_CDK2-associated protein p45,F-box protein Skp2,F-box_WD-40 protein 1,FWD1,Mouse,Mus musculus,Skp2,S-phase kinase-associated protein 2
EIAAB14621 FBL4,FBL5,F-box and leucine-rich repeat protein 5,F-box protein FBL4_FBL5,F-box_LRR-repeat protein 5,FBXL5,FLR1,Homo sapiens,Human,p45SKP2-like protein
EIAAB38587 Bos taurus,Bovine,Cyclin-A_CDK2-associated protein p19,p19A,p19skp1,SKP1,SKP1A,S-phase kinase-associated protein 1,S-phase kinase-associated protein 1A
EIAAB38584 Cyclin-A_CDK2-associated protein p19,p19A,p19skp1,Rat,Rattus norvegicus,Skp1,Skp1a,S-phase kinase-associated protein 1,S-phase kinase-associated protein 1A
EIAAB38586 Cyclin-A_CDK2-associated protein p19,Mouse,Mus musculus,p19A,p19skp1,Skp1,Skp1a,S-phase kinase-associated protein 1,S-phase kinase-associated protein 1A
EIAAB38583 Chicken,Cyclin-A_CDK2-associated protein p19,Gallus gallus,p19A,p19skp1,RCJMB04_11c19,SKP1,SKP1A,S-phase kinase-associated protein 1,S-phase kinase-associated protein 1A
EIAAB37520 Homo sapiens,Human,KIAA1454,MSTP063,S phase cyclin A-associated protein in the endoplasmic reticulum,S phase cyclin A-associated protein in the ER,SCAPER,Zinc finger protein 291,ZNF291
DL-SKP2-Hu Human S-Phase Kinase Associated Protein 2 (SKP2) ELISA Kit 96T
SKP2 SKP2 Gene S-phase kinase-associated protein 2 (p45)
EIAAB06540 Bos taurus,Bovine,CDK2AP2,CDK2-associated protein 2,Cyclin-dependent kinase 2-associated protein 2,DOC1R,DOC-1R,DOC-1-related protein
EIAAB06539 CDK2AP2,CDK2-associated protein 2,Cyclin-dependent kinase 2-associated protein 2,DOC1R,DOC-1R,DOC-1-related protein,Homo sapiens,Human
EIAAB06541 Cdk2ap2,CDK2-associated protein 2,Cyclin-dependent kinase 2-associated protein 2,D19Ertd144e,Doc1r,DOC-1R,DOC-1-related protein,Mouse,Mus musculus
E1889h ELISA kit CDK2,Cell division protein kinase 2,Cyclin-dependent kinase 2,Homo sapiens,Human,p33 protein kinase 96T
U1889h CLIA kit CDK2,Cell division protein kinase 2,Cyclin-dependent kinase 2,Homo sapiens,Human,p33 protein kinase 96T
U1889h CLIA CDK2,Cell division protein kinase 2,Cyclin-dependent kinase 2,Homo sapiens,Human,p33 protein kinase 96T
E1889h ELISA CDK2,Cell division protein kinase 2,Cyclin-dependent kinase 2,Homo sapiens,Human,p33 protein kinase 96T
orb90267 Human S-Phase Kinase-Associated Protein 2 protein SKP2 Human Recombinant produced in E.coli is a single, non-glycosylated, Polypeptide chain containing 205 amino acids (221-425 a.a.) fused to GST tag 2
201-20-5332 SKP2{S-phase kinase-associated protein 2 (p45)}rabbit.pAb 0.2ml
G8681 S-Phase Kinase Associated Protein 2 (SKP2), Human, ELISA Kit 96T
G8689 S-phase kinase-associated protein 2 (SKP2), Mouse, ELISA Kit 96T
G8688 S-phase kinase-associated protein 2 (SKP2), Human, ELISA Kit 96T
CSB-EL021362MO Mouse S-phase kinase-associated protein 2(SKP2) ELISA kit 96T
CSB-EL021362HU Human S-phase kinase-associated protein 2(SKP2) ELISA kit 96T
CSB-EL021362MO Mouse S-phase kinase-associated protein 2(SKP2) ELISA kit SpeciesMouse 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur