Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

SH2 domain-containing adapter protein B

 SHB_MOUSE               Reviewed;         503 AA.
Q6PD21; A2AKW3; Q3ULM3;
25-JUL-2006, integrated into UniProtKB/Swiss-Prot.
25-JUL-2006, sequence version 2.
25-APR-2018, entry version 104.
RecName: Full=SH2 domain-containing adapter protein B;
Name=Shb;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
STRAIN=C57BL/6J; TISSUE=Embryo;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=C57BL/6J; TISSUE=Fetal brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
TISSUE SPECIFICITY.
PubMed=8302579;
Welsh M., Mares J., Karlsson T., Lavergne C., Breant B.,
Claesson-Welsh L.;
"Shb is a ubiquitously expressed Src homology 2 protein.";
Oncogene 9:19-27(1994).
[5]
INDUCTION BY OKADAIC ACID AND GENISTEIN.
PubMed=8777141; DOI=10.1016/0898-6568(95)02019-5;
Lavergne C., Mares J., Karlsson T., Breant B., Welsh M.;
"Control of SHB gene expression by protein phosphorylation.";
Cell. Signal. 8:55-58(1996).
[6]
INTERACTION WITH PTPN11.
PubMed=12181353; DOI=10.1091/mbc.E02-02-0103;
Cross M.J., Lu L., Magnusson P., Nyqvist D., Holmqvist K., Welsh M.,
Claesson-Welsh L.;
"The Shb adaptor protein binds to tyrosine 766 in the FGFR-1 and
regulates the Ras/MEK/MAPK pathway via FRS2 phosphorylation in
endothelial cells.";
Mol. Biol. Cell 13:2881-2893(2002).
[7]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=17242355; DOI=10.1073/pnas.0609836104;
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
"Large-scale phosphorylation analysis of mouse liver.";
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-382, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19144319; DOI=10.1016/j.immuni.2008.11.006;
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,
Thibault P.;
"The phagosomal proteome in interferon-gamma-activated macrophages.";
Immunity 30:143-154(2009).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-382, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain, Heart, Kidney, Lung, and Pancreas;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: Adapter protein which regulates several signal
transduction cascades by linking activated receptors to downstream
signaling components. May play a role in angiogenesis by
regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role
in T-cell antigen receptor/TCR signaling, interleukin-2 signaling,
apoptosis and neuronal cells differentiation by mediating basic-
FGF and NGF-induced signaling cascades. May also regulate IRS1 and
IRS2 signaling in insulin-producing cells (By similarity).
{ECO:0000250}.
-!- SUBUNIT: Interacts with phosphorylated 'Tyr-720' of the ligand-
activated receptor PDGFRA via its SH2 domain. Interacts with the
ligand-activated receptors PDGFRB, FGFR1, KDR/VEGFR2, IL2RB and
IL2RG. Interacts with EPS8 and V-SRC. Interacts with GRB2 and
GRAP. Interacts with CD3Z. Interacts with tyrosine-phosphorylated
LAT upon T-cell antigen receptor activation. Interacts with PLCG1.
Interacts with ZAP70, LCP2/SLP-76, VAV1 and GRAP2. Interacts with
JAK1 and JAK3. Interacts with PTK2/FAK1. Interacts with CRK/CrKII.
Interacts with IRS2 (By similarity). Interacts with PTPN11.
{ECO:0000250, ECO:0000269|PubMed:12181353}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Cell membrane
{ECO:0000250}; Peripheral membrane protein {ECO:0000250};
Cytoplasmic side {ECO:0000250}. Note=Associates with membrane
lipid rafts upon TCR stimulation. {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q6PD21-1; Sequence=Displayed;
Name=2;
IsoId=Q6PD21-2; Sequence=VSP_019848, VSP_019849, VSP_019850;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in heart, liver, brain and kidney
(at protein level). {ECO:0000269|PubMed:8302579}.
-!- INDUCTION: Up-regulated by okadaic acid and genistein.
{ECO:0000269|PubMed:8777141}.
-!- DOMAIN: The SH2 domain preferentially binds phosphopeptides with
the consensus sequence Y-[TVI]-X-L and mediates interaction with
PDGFRA, PDGFRB, FGRFR1, IL2RB, IL2RG, CD3Z and CRK/CrKII.
{ECO:0000250}.
-!- PTM: Phosphorylated upon PDGFRA, PDGFRB, TCR, IL2 receptor, FGFR1
or VEGFR2 activation. {ECO:0000250}.
-!- SEQUENCE CAUTION:
Sequence=AAH58986.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AK145414; BAE26425.1; -; mRNA.
EMBL; AL772376; CAM20448.1; -; Genomic_DNA.
EMBL; BC058986; AAH58986.1; ALT_INIT; mRNA.
CCDS; CCDS51173.1; -. [Q6PD21-1]
RefSeq; NP_001028478.1; NM_001033306.1. [Q6PD21-1]
UniGene; Mm.251716; -.
ProteinModelPortal; Q6PD21; -.
SMR; Q6PD21; -.
BioGrid; 230937; 1.
IntAct; Q6PD21; 2.
MINT; Q6PD21; -.
STRING; 10090.ENSMUSP00000060433; -.
iPTMnet; Q6PD21; -.
PhosphoSitePlus; Q6PD21; -.
PaxDb; Q6PD21; -.
PRIDE; Q6PD21; -.
Ensembl; ENSMUST00000061986; ENSMUSP00000060433; ENSMUSG00000044813. [Q6PD21-1]
GeneID; 230126; -.
KEGG; mmu:230126; -.
UCSC; uc008sst.2; mouse. [Q6PD21-1]
UCSC; uc008ssu.1; mouse. [Q6PD21-2]
CTD; 6461; -.
MGI; MGI:98294; Shb.
eggNOG; ENOG410IGWI; Eukaryota.
eggNOG; ENOG410XQJ2; LUCA.
GeneTree; ENSGT00390000015203; -.
HOGENOM; HOG000038038; -.
HOVERGEN; HBG066172; -.
InParanoid; Q6PD21; -.
OMA; RPDYREQ; -.
OrthoDB; EOG091G0I06; -.
PhylomeDB; Q6PD21; -.
TreeFam; TF325799; -.
Reactome; R-MMU-3928662; EPHB-mediated forward signaling.
Reactome; R-MMU-4420097; VEGFA-VEGFR2 Pathway.
ChiTaRS; Shb; mouse.
PRO; PR:Q6PD21; -.
Proteomes; UP000000589; Chromosome 4.
Bgee; ENSMUSG00000044813; -.
ExpressionAtlas; Q6PD21; baseline and differential.
Genevisible; Q6PD21; MM.
GO; GO:0036464; C:cytoplasmic ribonucleoprotein granule; ISO:MGI.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0001784; F:phosphotyrosine residue binding; ISO:MGI.
GO; GO:0005070; F:SH3/SH2 adaptor activity; TAS:MGI.
GO; GO:0001525; P:angiogenesis; IEA:UniProtKB-KW.
GO; GO:0006915; P:apoptotic process; IEA:UniProtKB-KW.
GO; GO:0042100; P:B cell proliferation; IDA:MGI.
GO; GO:0001568; P:blood vessel development; IMP:MGI.
GO; GO:0048514; P:blood vessel morphogenesis; IMP:MGI.
GO; GO:0030154; P:cell differentiation; IEA:UniProtKB-KW.
GO; GO:0071425; P:hematopoietic stem cell proliferation; IMP:MGI.
GO; GO:0030097; P:hemopoiesis; IMP:MGI.
GO; GO:1900194; P:negative regulation of oocyte maturation; IMP:MGI.
GO; GO:0006469; P:negative regulation of protein kinase activity; IMP:MGI.
GO; GO:0045931; P:positive regulation of mitotic cell cycle; IMP:MGI.
GO; GO:0045624; P:positive regulation of T-helper cell differentiation; IMP:MGI.
GO; GO:0050852; P:T cell receptor signaling pathway; IMP:MGI.
CDD; cd10389; SH2_SHB; 1.
Gene3D; 3.30.505.10; -; 1.
InterPro; IPR000980; SH2.
InterPro; IPR036860; SH2_dom_sf.
InterPro; IPR035040; SHB.
InterPro; IPR035045; SHB_SH2.
PANTHER; PTHR15127:SF31; PTHR15127:SF31; 1.
Pfam; PF00017; SH2; 1.
PRINTS; PR00401; SH2DOMAIN.
SMART; SM00252; SH2; 1.
SUPFAM; SSF55550; SSF55550; 1.
PROSITE; PS50001; SH2; 1.
1: Evidence at protein level;
Alternative splicing; Angiogenesis; Apoptosis; Cell membrane;
Complete proteome; Cytoplasm; Developmental protein; Differentiation;
Isopeptide bond; Membrane; Phosphoprotein; Reference proteome;
SH2 domain; Ubl conjugation.
CHAIN 1 503 SH2 domain-containing adapter protein B.
/FTId=PRO_0000246325.
DOMAIN 404 498 SH2. {ECO:0000255|PROSITE-
ProRule:PRU00191}.
MOD_RES 101 101 Phosphoserine.
{ECO:0000250|UniProtKB:Q15464}.
MOD_RES 301 301 Phosphoserine.
{ECO:0000250|UniProtKB:Q15464}.
MOD_RES 311 311 Phosphoserine.
{ECO:0000250|UniProtKB:Q15464}.
MOD_RES 382 382 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
CROSSLNK 186 186 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000250|UniProtKB:Q15464}.
VAR_SEQ 1 262 Missing (in isoform 2).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_019848.
VAR_SEQ 443 479 KSNQGFMHMKLAKTKEKYVLGQNSPPFDSVPEVIHYY ->
NYADPEAVCAMPILPRTARPSVRPSVHPSVRKICARR (in
isoform 2).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_019849.
VAR_SEQ 480 503 Missing (in isoform 2).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_019850.
SEQUENCE 503 AA; 54708 MW; 9A668DFC429F41E3 CRC64;
MAKWLNKYFS LGNSKTKSPP QPPRPDYREQ RRRGERREQP PQAVPQACSA SSASCGSAAA
CFSASSGSLP DDSGSTSDLI RAYRAQKERD FEDPYNGPGS SLRKLRAMCR LDYCGGGGGG
DPGGGQRAFT AAAGAAGCCC AAAGAGAAAS SSSSSGSPHL YRSSSERRPT TPAEVRYISP
KHRLIKVESA SAAGDPPGGV CSGGRTWSPT TCGGKKLLNK CSAEETGAGQ KDKVTIADDY
SDPFDAKSDL KSKAGKGESA GYMEPYEAQR IMTEFQRQES VRSQHKGIQL YDTPYEPEGQ
SVDSDSESTV SLRLRESKLP QDDDRPADEY DQPWEWNRVT IPALAAQFNG NEKRQSSPSP
SRDRRRQLRA PGGGFKPIKH GSPEFCGILG ERVDPTIPLE KQIWYHGAIS RSDAENLLRL
CKECSYLVRN SQTSKHDYSL SLKSNQGFMH MKLAKTKEKY VLGQNSPPFD SVPEVIHYYT
TRKLPIKGAE HLSLLYPVAV RTL


Related products :

Catalog number Product name Quantity
EIAAB41674 Mouse,Mus musculus,Ticam1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-containing adapter protein inducing IFN-beta,Toll-interleukin-1 receptor domain-containing adapter protein inducin
EIAAB42483 Adaptor protein Wyatt,Homo sapiens,Human,MAL,MyD88 adapter-like protein,TIR domain-containing adapter protein,TIRAP,Toll_interleukin-1 receptor domain-containing adapter protein
EIAAB42482 Adaptor protein Wyatt,Mal,Mouse,Mus musculus,MyD88 adapter-like protein,TIR domain-containing adapter protein,Tirap,Toll_interleukin-1 receptor domain-containing adapter protein
EIAAB41675 Bos taurus,Bovine,TICAM1,TICAM-1,TIR domain-containing adapter molecule 1,TIR domain-containing adapter protein inducing IFN-beta,Toll-interleukin-1 receptor domain-containing adapter protein inducing
18-661-15155 Toll-interleukin 1 receptor domain-containing adapter protein - TIR domain-containing adapter protein; MyD88 adapter-like protein; Adaptor protein Wyatt Polyclonal 0.1 mg
18-661-15156 Toll-interleukin 1 receptor domain-containing adapter protein - TIR domain-containing adapter protein; MyD88 adapter-like protein; Adaptor protein Wyatt Polyclonal 0.1 mg
E1600h ELISA BASH,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,BLNK,Cytoplasmic adapter protein,Homo sapiens,Human,SLP65,SLP- 96T
E1600h ELISA kit BASH,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,BLNK,Cytoplasmic adapter protein,Homo sapiens,Human,SLP65 96T
U1600h CLIA BASH,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,BLNK,Cytoplasmic adapter protein,Homo sapiens,Human,SLP65,SLP-6 96T
E1600m ELISA kit Bash,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,Blnk,Cytoplasmic adapter protein,Ly57,Lymphocyte antigen 96T
E1600m ELISA Bash,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,Blnk,Cytoplasmic adapter protein,Ly57,Lymphocyte antigen 57,Mo 96T
U1600m CLIA Bash,B-cell adapter containing a SH2 domain protein,B-cell adapter containing a Src homology 2 domain protein,B-cell linker protein,Blnk,Cytoplasmic adapter protein,Ly57,Lymphocyte antigen 57,Mou 96T
EIAAB38183 Homo sapiens,Human,SCAP,SH2 domain-containing adapter protein,SH2 domain-containing protein 2A,SH2D2A,T cell-specific adapter protein,TSAd,TSAD,VEGF receptor-associated protein,VRAP
EIAAB38195 Adapter protein with pleckstrin homology and Src homology 2 domains,APS,Homo sapiens,Human,SH2 and PH domain-containing adapter protein APS,SH2B adapter protein 2,SH2B2
EIAAB38193 Adapter protein with pleckstrin homology and Src homology 2 domains,Aps,Rat,Rattus norvegicus,SH2 and PH domain-containing adapter protein APS,SH2B adapter protein 2,Sh2b2
EIAAB38194 Adapter protein with pleckstrin homology and Src homology 2 domains,Aps,Mouse,Mus musculus,SH2 and PH domain-containing adapter protein APS,SH2B adapter protein 2,Sh2b2
18-272-196229 BLNK - Rabbit polyclonal to BLNK; Cytoplasmic adapter protein; B-cell adapter containing SH2 domain protein; B-cell adapter containing Src homology 2 domain protein; Src homology 2 domain-containing l 0.1 mg
EIAAB31262 FAPP1,FAPP-1,Homo sapiens,Human,PH domain-containing family A member 3,Phosphatidylinositol-four-phosphate adapter protein 1,Phosphoinositol 4-phosphate adapter protein 1,Pleckstrin homology domain-co
EIAAB31273 Fapp2,FAPP-2,Mouse,Mus musculus,PH domain-containing family A member 8,Phosphatidylinositol-four-phosphate adapter protein 2,Phosphoinositol 4-phosphate adapter protein 2,Pleckstrin homology domain-co
EIAAB31263 Fapp1,FAPP-1,Mouse,Mus musculus,PH domain-containing family A member 3,Phosphatidylinositol-four-phosphate adapter protein 1,Phosphoinositol 4-phosphate adapter protein 1,Pleckstrin homology domain-co
18-661-15184 TRIF-related adapter molecule - TICAM2 protein; TIRAP3a; TIRAP3a short form; TIR-containing adapter molecule-2; TIR domain-containing adapter protein; Putative NFkB activating protein Polyclonal 0.1 mg
18-661-15165 TRIF-related adapter molecule - TICAM2 protein; TIRAP3a; TIRAP3a short form; TIR-containing adapter molecule-2; TIR domain-containing adapter protein; Putative NFkB activating protein Polyclonal 0.1 mg
E1600c ELISA BASH,B-cell adapter SH2 domain-containing protein,B-cell linker protein,BLNK,Chicken,Cytoplasmic adapter protein,Gallus gallus,SLP-65,Src homology 2 domain-containing leukocyte protein of 65 kDa 96T
E1600c ELISA kit BASH,B-cell adapter SH2 domain-containing protein,B-cell linker protein,BLNK,Chicken,Cytoplasmic adapter protein,Gallus gallus,SLP-65,Src homology 2 domain-containing leukocyte protein of 6 96T
U1600c CLIA BASH,B-cell adapter SH2 domain-containing protein,B-cell linker protein,BLNK,Chicken,Cytoplasmic adapter protein,Gallus gallus,SLP-65,Src homology 2 domain-containing leukocyte protein of 65 kDa 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur