Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

SLAM family member 7 (CD2 subset 1) (CD2-like receptor-activating cytotoxic cells) (CRACC) (Membrane protein FOAP-12) (Novel Ly9) (Protein 19A) (CD antigen CD319)

 SLAF7_HUMAN             Reviewed;         335 AA.
Q9NQ25; A8K3U1; B4DPU4; B4DPY3; B4DWA3; Q8N6Y8; Q8ND32; Q9NY08;
Q9NY23;
24-MAY-2005, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
27-SEP-2017, entry version 145.
RecName: Full=SLAM family member 7;
AltName: Full=CD2 subset 1;
AltName: Full=CD2-like receptor-activating cytotoxic cells;
Short=CRACC;
AltName: Full=Membrane protein FOAP-12;
AltName: Full=Novel Ly9;
AltName: Full=Protein 19A;
AltName: CD_antigen=CD319;
Flags: Precursor;
Name=SLAMF7; Synonyms=CS1; ORFNames=UNQ576/PRO1138;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND TISSUE SPECIFICITY.
PubMed=11220635; DOI=10.1007/s002510000274;
Boles K.S., Mathew P.A.;
"Molecular cloning of CS1, a novel human natural killer cell receptor
belonging to the CD2 subset of the immunoglobulin superfamily.";
Immunogenetics 52:302-307(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, AND TISSUE
SPECIFICITY.
PubMed=11698418; DOI=10.4049/jimmunol.167.10.5517;
Bouchon A., Cella M., Grierson H.L., Cohen J.I., Colonna M.;
"Activation of NK cell-mediated cytotoxicity by a SAP-independent
receptor of the CD2 family.";
J. Immunol. 167:5517-5521(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, AND TISSUE
SPECIFICITY.
PubMed=11802771; DOI=10.1042/0264-6021:3610431;
Murphy J.J., Hobby P., Vilarino-Varela J., Bishop B., Iordanidou P.,
Sutton B.J., Norton J.D.;
"A novel immunoglobulin superfamily receptor (19A) related to CD2 is
expressed on activated lymphocytes and promotes homotypic B-cell
adhesion.";
Biochem. J. 361:431-436(2002).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Macrophage;
Fujii Y., Takayama K., Tsuritani K., Yajima Y., Amemiya T., Ukai Y.,
Naito K., Kawaguchi A.;
"Homo sapiens mRNA for FOAP-12 protein, complete cds.";
Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4; 6 AND 7).
TISSUE=Lung, and Synovium;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Lymph node;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Fetal lung, and Fetal spleen;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[11]
PROTEIN SEQUENCE OF 23-37.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally
verified cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[12]
ALTERNATIVE SPLICING (ISOFORM 3).
PubMed=15368295; DOI=10.1002/eji.200424917;
Lee J.K., Boles K.S., Mathew P.A.;
"Molecular and functional characterization of a CS1 (CRACC) splice
variant expressed in human NK cells that does not contain
immunoreceptor tyrosine-based switch motifs.";
Eur. J. Immunol. 34:2791-2799(2004).
[13]
TISSUE SPECIFICITY, AND INTERACTION WITH SH2D1A.
PubMed=12242590; DOI=10.1007/s00251-002-0483-3;
Tovar V., Del Valle J., Zapater N., Martin M., Romero X., Pizcueta P.,
Bosch J., Terhorst C., Engel P.;
"Mouse novel Ly9: a new member of the expanding CD150 (SLAM) family of
leukocyte cell-surface receptors.";
Immunogenetics 54:394-402(2002).
[14]
FUNCTION, AND INTERACTION WITH SH2D1B.
PubMed=16339536; DOI=10.4049/jimmunol.175.12.7996;
Tassi I., Colonna M.;
"The cytotoxicity receptor CRACC (CS-1) recruits EAT-2 and activates
the PI3K and phospholipase Cgamma signaling pathways in human NK
cells.";
J. Immunol. 175:7996-8002(2005).
[15]
FUNCTION, AND TISSUE SPECIFICITY.
PubMed=23695528; DOI=10.1007/s00011-013-0632-1;
Kim J.R., Horton N.C., Mathew S.O., Mathew P.A.;
"CS1 (SLAMF7) inhibits production of proinflammatory cytokines by
activated monocytes.";
Inflamm. Res. 62:765-772(2013).
[16]
INVOLVEMENT IN SYSTEMIC LUPUS ERYTHEMATOSUS.
PubMed=23956418; DOI=10.4049/jimmunol.1301022;
Hagberg N., Theorell J., Schlums H., Eloranta M.L., Bryceson Y.T.,
Roennblom L.;
"Systemic lupus erythematosus immune complexes increase the expression
of SLAM family members CD319 (CRACC) and CD229 (LY-9) on plasmacytoid
dendritic cells and CD319 on CD56(dim) NK cells.";
J. Immunol. 191:2989-2998(2013).
-!- FUNCTION: Self-ligand receptor of the signaling lymphocytic
activation molecule (SLAM) family. SLAM receptors triggered by
homo- or heterotypic cell-cell interactions are modulating the
activation and differentiation of a wide variety of immune cells
and thus are involved in the regulation and interconnection of
both innate and adaptive immune response. Activities are
controlled by presence or absence of small cytoplasmic adapter
proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK
cell activation through a SH2D1A-independent extracellular signal-
regulated ERK-mediated pathway (PubMed:11698418). Positively
regulates NK cell functions by a mechanism dependent on
phosphorylated SH2D1B. Downstream signaling implicates PLCG1,
PLCG2 and PI3K (PubMed:16339536). In addition to heterotypic NK
cells-target cells interactions also homotypic interactions
between NK cells may contribute to activation. However, in the
absence of SH2D1B, inhibits NK cell function. Acts also inhibitory
in T-cells (By similarity). May play a role in lymphocyte adhesion
(PubMed:11802771). In LPS-activated monocytes negatively regulates
production of proinflammatory cytokines (PubMed:23695528).
{ECO:0000250|UniProtKB:Q8BHK6, ECO:0000269|PubMed:11698418,
ECO:0000269|PubMed:11802771, ECO:0000269|PubMed:16339536,
ECO:0000269|PubMed:23695528, ECO:0000269|Ref.4}.
-!- FUNCTION: Isoform 3 does not mediate any NK cell activation.
-!- SUBUNIT: Isoform 1 binds to SH2D1A when its cytoplasmic tail is
phosphorylated in the presence of FYN (in vitro); low affinity
binding, the physiological relevance of the interaction is
questioned. Interacts with SH2D1B; in NK cells (PubMed:16339536).
Interacts (via ITSM phosphorylated on Tyr-302) with SH2D1B,
PTPN6/SHP-1, PTPN11/SHP-2, INPP5D/SHIP1, CSK and FYN (By
similarity). {ECO:0000250|UniProtKB:Q8BHK6,
ECO:0000269|PubMed:12242590, ECO:0000269|PubMed:16339536}.
-!- INTERACTION:
Self; NbExp=2; IntAct=EBI-3916159, EBI-3916159;
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane
protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1; Synonyms=19A, CS1-L;
IsoId=Q9NQ25-1; Sequence=Displayed;
Name=2;
IsoId=Q9NQ25-2; Sequence=VSP_013781;
Note=No experimental confirmation available.;
Name=3; Synonyms=19A24, CS1-S;
IsoId=Q9NQ25-3; Sequence=VSP_013782;
Name=4;
IsoId=Q9NQ25-4; Sequence=VSP_054540, VSP_054541;
Note=No experimental confirmation available.;
Name=5;
IsoId=Q9NQ25-5; Sequence=VSP_054542;
Note=No experimental confirmation available.;
Name=6;
IsoId=Q9NQ25-6; Sequence=VSP_055292;
Note=No experimental confirmation available.;
Name=7;
IsoId=Q9NQ25-7; Sequence=VSP_013781, VSP_055293;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in spleen, lymph node, peripheral
blood leukocytes, bone marrow, small intestine, stomach, appendix,
lung and trachea. Expression was detected in NK cells, activated
B-cells, NK-cell line but not in promyelocytic, B-, or T-cell
lines. Expressed in monocytes. Isoform 3 is expressed at much
lower level than isoform 1. {ECO:0000269|PubMed:11220635,
ECO:0000269|PubMed:11698418, ECO:0000269|PubMed:11802771,
ECO:0000269|PubMed:12242590, ECO:0000269|PubMed:23695528}.
-!- DOMAIN: The ITSMs (immunoreceptor tyrosine-based switch motifs)
with the consensus sequence T-X-Y-X-X-[VI] present in SLAM family
receptors have overlapping specificity for activating and
inhibitory SH2 domain-containing binding partners. Especially they
mediate the interaction with the SH2 domain of SH2D1A and SH2D1B.
A 'three-pronged' mechanism is proposed involving threonine
(position -2), phosphorylated tyrosine (position 0) and
valine/isoleucine (position +3). {ECO:0000250|UniProtKB:Q13291}.
-!- MISCELLANEOUS: Proposed to be involved in systemic lupus
erythematosus (SLE) disease process.
{ECO:0000269|PubMed:23956418}.
-!- SEQUENCE CAUTION:
Sequence=CAB76561.1; Type=Frameshift; Positions=Several; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF291815; AAK11549.1; -; mRNA.
EMBL; AF390894; AAL26989.1; -; mRNA.
EMBL; AJ271869; CAB76561.1; ALT_FRAME; mRNA.
EMBL; AJ276429; CAB81950.2; -; mRNA.
EMBL; AB027233; BAB61022.1; -; mRNA.
EMBL; AY358512; AAQ88876.1; -; mRNA.
EMBL; AK290706; BAF83395.1; -; mRNA.
EMBL; AK298499; BAG60706.1; -; mRNA.
EMBL; AK298548; BAG60745.1; -; mRNA.
EMBL; AK301438; BAG62965.1; -; mRNA.
EMBL; AL834424; CAD39085.1; -; mRNA.
EMBL; AL121985; CAC00579.1; -; Genomic_DNA.
EMBL; AL121985; CAH73507.1; -; Genomic_DNA.
EMBL; AL121985; CAH73508.1; -; Genomic_DNA.
EMBL; CH471121; EAW52704.1; -; Genomic_DNA.
EMBL; BC027867; AAH27867.1; -; mRNA.
CCDS; CCDS1209.1; -. [Q9NQ25-1]
CCDS; CCDS60321.1; -. [Q9NQ25-5]
CCDS; CCDS60322.1; -. [Q9NQ25-6]
CCDS; CCDS60323.1; -. [Q9NQ25-4]
CCDS; CCDS60324.1; -. [Q9NQ25-2]
CCDS; CCDS60325.1; -. [Q9NQ25-7]
RefSeq; NP_001269517.1; NM_001282588.1. [Q9NQ25-4]
RefSeq; NP_001269518.1; NM_001282589.1. [Q9NQ25-6]
RefSeq; NP_001269519.1; NM_001282590.1. [Q9NQ25-2]
RefSeq; NP_001269520.1; NM_001282591.1. [Q9NQ25-7]
RefSeq; NP_001269521.1; NM_001282592.1. [Q9NQ25-5]
RefSeq; NP_001269524.1; NM_001282595.1.
RefSeq; NP_067004.3; NM_021181.4. [Q9NQ25-1]
UniGene; Hs.517265; -.
ProteinModelPortal; Q9NQ25; -.
SMR; Q9NQ25; -.
BioGrid; 121782; 16.
ELM; Q9NQ25; -.
IntAct; Q9NQ25; 6.
MINT; MINT-4722730; -.
STRING; 9606.ENSP00000357022; -.
ChEMBL; CHEMBL3559386; -.
DrugBank; DB06317; Elotuzumab.
GuidetoPHARMACOLOGY; 2850; -.
iPTMnet; Q9NQ25; -.
PhosphoSitePlus; Q9NQ25; -.
DMDM; 66774034; -.
MaxQB; Q9NQ25; -.
PaxDb; Q9NQ25; -.
PeptideAtlas; Q9NQ25; -.
PRIDE; Q9NQ25; -.
TopDownProteomics; Q9NQ25-2; -. [Q9NQ25-2]
DNASU; 57823; -.
Ensembl; ENST00000359331; ENSP00000352281; ENSG00000026751. [Q9NQ25-5]
Ensembl; ENST00000368042; ENSP00000357021; ENSG00000026751. [Q9NQ25-2]
Ensembl; ENST00000368043; ENSP00000357022; ENSG00000026751. [Q9NQ25-1]
Ensembl; ENST00000441662; ENSP00000405605; ENSG00000026751. [Q9NQ25-6]
Ensembl; ENST00000444090; ENSP00000416592; ENSG00000026751. [Q9NQ25-4]
Ensembl; ENST00000458602; ENSP00000409965; ENSG00000026751. [Q9NQ25-7]
GeneID; 57823; -.
KEGG; hsa:57823; -.
UCSC; uc001fwq.5; human. [Q9NQ25-1]
CTD; 57823; -.
DisGeNET; 57823; -.
EuPathDB; HostDB:ENSG00000026751.16; -.
GeneCards; SLAMF7; -.
HGNC; HGNC:21394; SLAMF7.
HPA; CAB015445; -.
HPA; HPA055945; -.
HPA; HPA061654; -.
MIM; 606625; gene.
neXtProt; NX_Q9NQ25; -.
OpenTargets; ENSG00000026751; -.
PharmGKB; PA134977110; -.
eggNOG; ENOG410IJW6; Eukaryota.
eggNOG; ENOG41117FX; LUCA.
GeneTree; ENSGT00530000063114; -.
HOGENOM; HOG000013065; -.
HOVERGEN; HBG079189; -.
InParanoid; Q9NQ25; -.
KO; K06733; -.
OMA; EDVTYSW; -.
OrthoDB; EOG091G0KKU; -.
PhylomeDB; Q9NQ25; -.
TreeFam; TF334964; -.
Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
GeneWiki; SLAMF7; -.
GenomeRNAi; 57823; -.
PRO; PR:Q9NQ25; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000026751; -.
CleanEx; HS_SLAMF7; -.
ExpressionAtlas; Q9NQ25; baseline and differential.
Genevisible; Q9NQ25; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0002250; P:adaptive immune response; IEA:UniProtKB-KW.
GO; GO:0007155; P:cell adhesion; NAS:UniProtKB.
GO; GO:0030101; P:natural killer cell activation; NAS:UniProtKB.
GO; GO:0042267; P:natural killer cell mediated cytotoxicity; NAS:UniProtKB.
GO; GO:0050776; P:regulation of immune response; TAS:Reactome.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR013783; Ig-like_fold.
SUPFAM; SSF48726; SSF48726; 2.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
Adaptive immunity; Alternative splicing; Complete proteome;
Direct protein sequencing; Disulfide bond; Glycoprotein; Immunity;
Immunoglobulin domain; Innate immunity; Membrane; Polymorphism;
Receptor; Reference proteome; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 22 {ECO:0000269|PubMed:15340161}.
CHAIN 23 335 SLAM family member 7.
/FTId=PRO_0000014963.
TOPO_DOM 23 226 Extracellular. {ECO:0000255}.
TRANSMEM 227 247 Helical. {ECO:0000255}.
TOPO_DOM 248 335 Cytoplasmic. {ECO:0000255}.
DOMAIN 23 124 Ig-like V-type.
DOMAIN 131 206 Ig-like C2-type.
REGION 278 296 Interaction with FYN when phosphorylated
at Tyr-284.
{ECO:0000250|UniProtKB:Q8BHK6}.
MOTIF 302 307 ITSM. {ECO:0000250|UniProtKB:Q13291,
ECO:0000250|UniProtKB:Q8BHK6}.
CARBOHYD 98 98 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 142 142 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 148 148 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 172 172 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 176 176 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 204 204 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 145 215 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 151 195 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 19 125 Missing (in isoform 2 and isoform 7).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:17974005}.
/FTId=VSP_013781.
VAR_SEQ 126 256 Missing (in isoform 6).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_055292.
VAR_SEQ 127 165 HLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWK
-> NNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAIC
L (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054540.
VAR_SEQ 166 335 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_054541.
VAR_SEQ 217 256 Missing (in isoform 7).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_055293.
VAR_SEQ 258 335 YIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKED
PANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI ->
NNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAICL
(in isoform 5). {ECO:0000305}.
/FTId=VSP_054542.
VAR_SEQ 258 296 YIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILK
-> NNPKGRSSKYGLLHCGNTEKDGKSPLTAHDARHTKAIC
L (in isoform 3).
{ECO:0000303|PubMed:11802771,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_013782.
VARIANT 175 175 H -> Y (in dbSNP:rs35325048).
/FTId=VAR_049938.
VARIANT 302 302 T -> M (in dbSNP:rs2295617).
/FTId=VAR_049939.
CONFLICT 135 135 M -> L (in Ref. 3; CAB81950).
{ECO:0000305}.
SEQUENCE 335 AA; 37421 MW; D09ABBCFF74BE8D4 CRC64;
MAGSPTCLTL IYILWQLTGS AASGPVKELV GSVGGAVTFP LKSKVKQVDS IVWTFNTTPL
VTIQPEGGTI IVTQNRNRER VDFPDGGYSL KLSKLKKNDS GIYYVGIYSS SLQQPSTQEY
VLHVYEHLSK PKVTMGLQSN KNGTCVTNLT CCMEHGEEDV IYTWKALGQA ANESHNGSIL
PISWRWGESD MTFICVARNP VSRNFSSPIL ARKLCEGAAD DPDSSMVLLC LLLVPLLLSL
FVLGLFLWFL KRERQEEYIE EKKRVDICRE TPNICPHSGE NTEYDTIPHT NRTILKEDPA
NTVYSTVEIP KKMENPHSLL TMPDTPRLFA YENVI


Related products :

Catalog number Product name Quantity
EIAAB38628 CD2 subset 1,CD2-like receptor-activating cytotoxic cells,CRACC,CS1,Homo sapiens,Human,Membrane protein FOAP-12,Novel Ly9,Protein 19A,SLAM family member 7,SLAMF7,UNQ576_PRO1138
C316 Recombinant Human SLAM Family Member 7 per SLAMF7 per CD319 per CRACC (C-6His) 10ug
EIAAB38627 Activating NK receptor,Homo sapiens,Human,KALI,NK-T-B-antigen,NTB-A,SLAM family member 6,SLAMF6,UNQ6123_PRO20080
EIAAB27283 CD159 antigen-like family member C,Homo sapiens,Human,KLRC2,NK cell receptor C,NKG2C,NKG2-C type II integral membrane protein,NKG2-C-activating NK receptor
EIAAB27282 CD159 antigen-like family member A,Homo sapiens,Human,KLRC1,NK cell receptor A,NKG2A,NKG2-A_B-activating NK receptor,NKG2-A_NKG2-B type II integral membrane protein
31-020 The protein encoded by TIAL1 is a member of a family of RNA-binding proteins and possesses nucleolytic activity against cytotoxic lymphocyte target cells. The gene product is a cytotoxic granule-assoc 0.1 mg
101-M339 CRACC Anti-Human Host: Mouse SLAMF7; 19A; CS1; CD319; CRACC 100
101-M339 CRACC, Host: Mouse, Species: Anti-Human, Synonyms: SLAMF7; 19A; CS1; CD319; CRACC 100 ug
29-459 TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the indu 0.05 mg
25-657 TIA1 is a member of a RNA-binding protein family and possesses nucleolytic activity against cytotoxic lymphocyte (CTL) target cells. It has been suggested that this protein may be involved in the indu 0.05 mg
11691-H08H SLAMF7 _ CRACC _ CD319 Protein (His Tag) 100
EIAAB38631 BCM-like membrane protein,BLAME,B-lymphocyte activator macrophage expressed,Homo sapiens,Human,SLAM family member 8,SLAMF8
32-134 CD8 T cell surface antigen is heterodimer of an alpha and a beta chain linked by two disulfide bonds .It belongs type I membrane protein. Selectively expressing of CD8 on a subset of T cells leads to 0.1 mg
30-542 LMBR1 is a member of the LMBR1-like membrane protein family. Another member of this protein family has been shown to be a lipocalin transmembrane receptor. A highly conserved, cis-acting regulatory mo 0.05 mg
U0115r CLIA CD62 antigen-like family member P,GMP-140,Granule membrane protein 140,LECAM3,Leukocyte-endothelial cell adhesion molecule 3,PADGEM,Platelet activation dependent granule-external membrane protein 96T
EIAAB38323 Bit,Bit,Brain Ig-like molecule with tyrosine-based activation motifs,CD172 antigen-like family member A,Inhibitory receptor SHPS-1,Macrophage fusion receptor,Macrophage membrane protein MFP150,Mfr,Ptp
EIAAB37061 Homo sapiens,Human,Protein FOAP-13,PSEC0252,SLC43A3,Solute carrier family 43 member 3
EIAAB37068 Aim1,Matp,Melanoma antigen AIM1,Membrane-associated transporter protein,Mouse,Mus musculus,Protein AIM-1,Protein underwhite,Slc45a2,Solute carrier family 45 member 2,uw
E1464h ELISA kit CD107 antigen-like family member B,Homo sapiens,Human,LAMP2,LAMP-2,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 2 96T
U1464h CLIA CD107 antigen-like family member B,Homo sapiens,Human,LAMP2,LAMP-2,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 2 96T
E1464h ELISA CD107 antigen-like family member B,Homo sapiens,Human,LAMP2,LAMP-2,Lysosome-associated membrane glycoprotein 2,Lysosome-associated membrane protein 2 96T
26-210 LAX1 is a single-pass type III membrane protein. It negatively regulates TCR (T-cell antigen receptor)-mediated signaling in T-cells and BCR (B-cell antigen receptor)-mediated signaling in B-cells. 0.05 mg
25-172 The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move 0.05 mg
27-980 The protein encoded by the KIF25 gene is a member of the kinesin-like protein family. Protein family members are microtubule-dependent molecular motors that transport organelles within cells and move 0.1 mg
12-2229-42 Anti-Human CD319 (CRACC) PE 100 tests


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur