Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Seipin (Bernardinelli-Seip congenital lipodystrophy type 2 protein)

 BSCL2_HUMAN             Reviewed;         398 AA.
Q96G97; G3XAE4; Q567S1; Q96SV1; Q9BSQ0;
26-APR-2005, integrated into UniProtKB/Swiss-Prot.
24-NOV-2009, sequence version 3.
05-DEC-2018, entry version 147.
RecName: Full=Seipin;
AltName: Full=Bernardinelli-Seip congenital lipodystrophy type 2 protein;
Name=BSCL2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1] {ECO:0000305, ECO:0000312|EMBL:BAC11543.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Retinoblastoma {ECO:0000312|EMBL:BAC11543.1}, and
Teratocarcinoma {ECO:0000312|EMBL:BAB55175.1};
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2] {ECO:0000305}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
Yu W., Sarginson J., Gibbs R.A.;
Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases.
[3] {ECO:0000305}
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16554811; DOI=10.1038/nature04632;
Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K.,
Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F.,
Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E.,
FitzGerald M.G., Jaffe D.B., LaButti K., Nicol R., Park H.-S.,
Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W.,
Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S.,
Sakaki Y.;
"Human chromosome 11 DNA sequence and analysis including novel gene
identification.";
Nature 440:497-500(2006).
[5] {ECO:0000305, ECO:0000312|EMBL:AAH04911.1}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Kidney {ECO:0000312|EMBL:AAH12140.1},
Lung {ECO:0000312|EMBL:AAH04911.1},
Pancreas {ECO:0000312|EMBL:AAH41640.1}, and Pituitary;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6] {ECO:0000305}
TISSUE SPECIFICITY, AND VARIANT CGL2 PRO-212.
PubMed=11479539; DOI=10.1038/ng585;
Magre J., Delepine M., Khallouf E., Gedde-Dahl T. Jr.,
Van Maldergem L., Sobel E., Papp J., Meier M., Megarbane A., Bachy A.,
Verloes A., d'Abronzo F.H., Seemanova E., Assan R., Baudic N.,
Bourut C., Czernichow P., Huet F., Grigorescu F., de Kerdanet M.,
Lacombe D., Labrune P., Lanza M., Loret H., Matsuda F., Navarro J.,
Nivelon-Chevalier A., Polak M., Robert J.J., Tric P., Tubiana-Rufi N.,
Vigouroux C., Weissenbach J., Savasta S., Maassen J.A., Trygstad O.,
Bogalho P., Freitas P., Medina J.L., Bonnicci F., Joffe B.I.,
Loyson G., Panz V.R., Raal F.J., O'Rahilly S., Stephenson T.,
Kahn C.R., Lathrop M., Capeau J.;
"Identification of the gene altered in Berardinelli-Seip congenital
lipodystrophy on chromosome 11q13.";
Nat. Genet. 28:365-370(2001).
[7] {ECO:0000305}
SUBCELLULAR LOCATION, GLYCOSYLATION AT ASN-88, AND VARIANTS SPG17 AND
HMN5A SER-88 AND LEU-90.
PubMed=14981520; DOI=10.1038/ng1313;
Windpassinger C., Auer-Grumbach M., Irobi J., Patel H., Petek E.,
Hoerl G., Malli R., Reed J.A., Dierick I., Verpoorten N., Warner T.T.,
Proukakis C., Van den Bergh P., Verellen C., Van Maldergem L.,
Merlini L., De Jonghe P., Timmerman V., Crosby A.H., Wagner K.;
"Heterozygous missense mutations in BSCL2 are associated with distal
hereditary motor neuropathy and Silver syndrome.";
Nat. Genet. 36:271-276(2004).
[8]
SUBCELLULAR LOCATION, AND TOPOLOGY.
PubMed=16574104; DOI=10.1016/j.febslet.2006.03.040;
Lundin C., Nordstrom R., Wagner K., Windpassinger C., Andersson H.,
von Heijne G., Nilsson I.;
"Membrane topology of the human seipin protein.";
FEBS Lett. 580:2281-2284(2006).
[9]
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND VARIANT PRO-212.
PubMed=18458148; DOI=10.2337/db08-0184;
Payne V.A., Grimsey N., Tuthill A., Virtue S., Gray S.L.,
Dalla Nora E., Semple R.K., O'Rahilly S., Rochford J.J.;
"The human lipodystrophy gene BSCL2/seipin may be essential for normal
adipocyte differentiation.";
Diabetes 57:2055-2060(2008).
[10]
TISSUE SPECIFICITY, AND CHARACTERIZATION OF VARIANT SPG17 SER-88.
PubMed=18585921; DOI=10.1016/j.nbd.2008.05.004;
Ito D., Fujisawa T., Iida H., Suzuki N.;
"Characterization of seipin/BSCL2, a protein associated with spastic
paraplegia 17.";
Neurobiol. Dis. 31:266-277(2008).
[11]
FUNCTION.
PubMed=19278620; DOI=10.1016/j.biochi.2009.01.011;
Boutet E., El Mourabit H., Prot M., Nemani M., Khallouf E., Colard O.,
Maurice M., Durand-Schneider A.M., Chretien Y., Gres S., Wolf C.,
Saulnier-Blache J.S., Capeau J., Magre J.;
"Seipin deficiency alters fatty acid Delta9 desaturation and lipid
droplet formation in Berardinelli-Seip congenital lipodystrophy.";
Biochimie 91:796-803(2009).
[12]
FUNCTION, AND VARIANT LEU-90.
PubMed=21533227; DOI=10.1371/journal.pgen.1001364;
Tian Y., Bi J., Shui G., Liu Z., Xiang Y., Liu Y., Wenk M.R., Yang H.,
Huang X.;
"Tissue-autonomous function of Drosophila seipin in preventing ectopic
lipid droplet formation.";
PLoS Genet. 7:E1001364-E1001364(2011).
[13]
INVOLVEMENT IN PELD.
PubMed=23564749; DOI=10.1136/jmedgenet-2013-101525;
Guillen-Navarro E., Sanchez-Iglesias S., Domingo-Jimenez R.,
Victoria B., Ruiz-Riquelme A., Rabano A., Loidi L., Beiras A.,
Gonzalez-Mendez B., Ramos A., Lopez-Gonzalez V.,
Ballesta-Martinez M.J., Garrido-Pumar M., Aguiar P., Ruibal A.,
Requena J.R., Araujo-Vilar D.;
"A new seipin-associated neurodegenerative syndrome.";
J. Med. Genet. 50:401-409(2013).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-289 AND SER-372, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[15]
VARIANT HMN5A SER-88, AND VARIANT SPG17 LEU-90.
PubMed=17663003; DOI=10.1016/j.jns.2007.06.047;
Rohkamm B., Reilly M.M., Lochmueller H., Schlotter-Weigel B.,
Barisic N., Schoels L., Nicholson G., Pareyson D., Laura M.,
Janecke A.R., Miltenberger-Miltenyi G., John E., Fischer C., Grill F.,
Wakeling W., Davis M., Pieber T.R., Auer-Grumbach M.;
"Further evidence for genetic heterogeneity of distal HMN type V, CMT2
with predominant hand involvement and Silver syndrome.";
J. Neurol. Sci. 263:100-106(2007).
[16]
VARIANT SPG17 LEU-90.
PubMed=24604904; DOI=10.1136/jnnp-2013-306740;
Klein C.J., Middha S., Duan X., Wu Y., Litchy W.J., Gu W., Dyck P.J.,
Gavrilova R.H., Smith D.I., Kocher J.P., Dyck P.J.;
"Application of whole exome sequencing in undiagnosed inherited
polyneuropathies.";
J. Neurol. Neurosurg. Psych. 85:1265-1272(2014).
-!- FUNCTION: Is a regulator of lipid catabolism essential for
adipocyte differentiation. May also be involved in the central
regulation of energy homeostasis (By similarity). Necessary for
correct lipid storage and lipid droplets maintenance; may play a
tissue-autonomous role in controlling lipid storage in adipocytes
and in preventing ectopic lipid droplet formation in non-adipose
tissues. {ECO:0000250, ECO:0000269|PubMed:19278620,
ECO:0000269|PubMed:21533227}.
-!- INTERACTION:
P42857:NSG1; NbExp=3; IntAct=EBI-10178113, EBI-6380741;
Q9H8W4:PLEKHF2; NbExp=3; IntAct=EBI-10178113, EBI-742388;
Q9BZL3:SMIM3; NbExp=4; IntAct=EBI-741806, EBI-741850;
H3BR10:SMLR1; NbExp=3; IntAct=EBI-10178113, EBI-10178109;
Q96HH6:TMEM19; NbExp=4; IntAct=EBI-741806, EBI-741829;
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000269|PubMed:14981520, ECO:0000269|PubMed:16574104,
ECO:0000269|PubMed:18458148}; Multi-pass membrane protein
{ECO:0000269|PubMed:14981520, ECO:0000269|PubMed:16574104,
ECO:0000269|PubMed:18458148}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q96G97-2; Sequence=Displayed;
Name=2;
IsoId=Q96G97-3; Sequence=VSP_051726, VSP_051727;
Note=No experimental confirmation available. {ECO:0000305};
Name=3;
IsoId=Q96G97-4; Sequence=VSP_044545;
Note=No experimental confirmation available. {ECO:0000305};
-!- TISSUE SPECIFICITY: Expressed in motor neurons in the spinal cord
and cortical neurons in the frontal lobe (at protein level).
Highly expressed in brain, testis and adipose tissue.
{ECO:0000269|PubMed:11479539, ECO:0000269|PubMed:18458148,
ECO:0000269|PubMed:18585921}.
-!- DISEASE: Congenital generalized lipodystrophy 2 (CGL2)
[MIM:269700]: An autosomal recessive disorder characterized by a
near complete absence of adipose tissue, extreme insulin
resistance, hypertriglyceridemia, hepatic steatosis and early
onset of diabetes. {ECO:0000269|PubMed:11479539}. Note=The disease
is caused by mutations affecting the gene represented in this
entry.
-!- DISEASE: Spastic paraplegia 17, autosomal dominant (SPG17)
[MIM:270685]: A form of spastic paraplegia, a neurodegenerative
disorder characterized by a slow, gradual, progressive weakness
and spasticity of the lower limbs. Rate of progression and the
severity of symptoms are quite variable. Initial symptoms may
include difficulty with balance, weakness and stiffness in the
legs, muscle spasms, and dragging the toes when walking. In some
forms of the disorder, bladder symptoms (such as incontinence) may
appear, or the weakness and stiffness may spread to other parts of
the body. SPG17 is characterized by prominent amyotrophy of the
hand muscles, the presence of mild to severe pyramidal tract signs
and spastic paraplegia. SPG17 is a motor neuron disease
overlapping with distal spinal muscular atrophy type 5.
{ECO:0000269|PubMed:14981520, ECO:0000269|PubMed:17663003,
ECO:0000269|PubMed:18585921, ECO:0000269|PubMed:24604904}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- DISEASE: Neuronopathy, distal hereditary motor, 5A (HMN5A)
[MIM:600794]: A disorder characterized by distal muscular atrophy
mainly affecting the upper extremities, in contrast to other
distal motor neuronopathies. These constitute a heterogeneous
group of neuromuscular diseases caused by selective degeneration
of motor neurons in the anterior horn of the spinal cord, without
sensory deficit in the posterior horn. The overall clinical
picture consists of a classical distal muscular atrophy syndrome
in the legs without clinical sensory loss. The disease starts with
weakness and wasting of distal muscles of the anterior tibial and
peroneal compartments of the legs. Later on, weakness and atrophy
may expand to the proximal muscles of the lower limbs and/or to
the distal upper limbs. {ECO:0000269|PubMed:14981520,
ECO:0000269|PubMed:17663003}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Encephalopathy, progressive, with or without
lipodystrophy (PELD) [MIM:615924]: A neurodegenerative disease
characterized by developmental regression of motor and cognitive
skills in the first years of life, often leading to death in the
first decade, hyperactive behavior, seizures, tremor and ataxic
gait. Patients may show a mild or typical lipodystrophic
appearance. {ECO:0000269|PubMed:23564749}. Note=The disease is
caused by mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the seipin family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK027524; BAB55175.1; -; mRNA.
EMBL; AK075317; BAC11543.1; -; mRNA.
EMBL; AF052149; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; CH471076; EAW74070.1; -; Genomic_DNA.
EMBL; CH471076; EAW74074.1; -; Genomic_DNA.
EMBL; AP001458; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC004911; AAH04911.1; -; mRNA.
EMBL; BC012140; AAH12140.1; -; mRNA.
EMBL; BC041640; AAH41640.1; -; mRNA.
EMBL; BC093048; AAH93048.1; -; mRNA.
CCDS; CCDS44627.1; -. [Q96G97-4]
CCDS; CCDS55769.1; -. [Q96G97-3]
CCDS; CCDS8031.1; -. [Q96G97-2]
RefSeq; NP_001116427.1; NM_001122955.3. [Q96G97-4]
RefSeq; NP_001124174.2; NM_001130702.2. [Q96G97-3]
RefSeq; NP_116056.3; NM_032667.6. [Q96G97-2]
UniGene; Hs.533709; -.
PDB; 6DS5; EM; 3.80 A; A/B/C/D/E/F/G/H/I/J/K=2-398.
PDBsum; 6DS5; -.
ProteinModelPortal; Q96G97; -.
SMR; Q96G97; -.
BioGrid; 117749; 44.
CORUM; Q96G97; -.
IntAct; Q96G97; 11.
MINT; Q96G97; -.
STRING; 9606.ENSP00000354032; -.
TCDB; 1.R.1.1.1; the membrane contact site (mcs) family.
CarbonylDB; Q96G97; -.
GlyConnect; 1728; -.
iPTMnet; Q96G97; -.
PhosphoSitePlus; Q96G97; -.
BioMuta; BSCL2; -.
DMDM; 269849705; -.
EPD; Q96G97; -.
PaxDb; Q96G97; -.
PeptideAtlas; Q96G97; -.
PRIDE; Q96G97; -.
ProteomicsDB; 76606; -.
ProteomicsDB; 76607; -. [Q96G97-3]
DNASU; 26580; -.
Ensembl; ENST00000278893; ENSP00000278893; ENSG00000168000. [Q96G97-3]
Ensembl; ENST00000360796; ENSP00000354032; ENSG00000168000. [Q96G97-4]
Ensembl; ENST00000403550; ENSP00000385561; ENSG00000168000. [Q96G97-2]
Ensembl; ENST00000407022; ENSP00000384080; ENSG00000168000. [Q96G97-2]
Ensembl; ENST00000421906; ENSP00000413209; ENSG00000168000. [Q96G97-2]
GeneID; 26580; -.
KEGG; hsa:26580; -.
UCSC; uc001nup.4; human. [Q96G97-2]
CTD; 26580; -.
DisGeNET; 26580; -.
EuPathDB; HostDB:ENSG00000168000.14; -.
GeneCards; BSCL2; -.
GeneReviews; BSCL2; -.
HGNC; HGNC:15832; BSCL2.
HPA; HPA042394; -.
MalaCards; BSCL2; -.
MIM; 269700; phenotype.
MIM; 270685; phenotype.
MIM; 600794; phenotype.
MIM; 606158; gene.
MIM; 615924; phenotype.
neXtProt; NX_Q96G97; -.
OpenTargets; ENSG00000168000; -.
Orphanet; 100998; Autosomal dominant spastic paraplegia type 17.
Orphanet; 528; Berardinelli-Seip congenital lipodystrophy.
Orphanet; 139536; Distal hereditary motor neuropathy type 5.
Orphanet; 363400; Severe neurodegenerative syndrome with lipodystrophy.
PharmGKB; PA25432; -.
eggNOG; KOG4200; Eukaryota.
eggNOG; ENOG4111GRP; LUCA.
GeneTree; ENSGT00390000011639; -.
HOGENOM; HOG000220875; -.
HOVERGEN; HBG050736; -.
InParanoid; Q96G97; -.
KO; K19365; -.
PhylomeDB; Q96G97; -.
TreeFam; TF314000; -.
ChiTaRS; BSCL2; human.
GeneWiki; BSCL2; -.
GenomeRNAi; 26580; -.
PRO; PR:Q96G97; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000168000; Expressed in 96 organ(s), highest expression level in testis.
CleanEx; HS_BSCL2; -.
ExpressionAtlas; Q96G97; baseline and differential.
Genevisible; Q96G97; HS.
GO; GO:0030176; C:integral component of endoplasmic reticulum membrane; IDA:UniProtKB.
GO; GO:0045444; P:fat cell differentiation; ISS:UniProtKB.
GO; GO:0016042; P:lipid catabolic process; IEA:UniProtKB-KW.
GO; GO:0034389; P:lipid droplet organization; IMP:UniProtKB.
GO; GO:0019915; P:lipid storage; IMP:UniProtKB.
GO; GO:0050995; P:negative regulation of lipid catabolic process; ISS:UniProtKB.
GO; GO:0120162; P:positive regulation of cold-induced thermogenesis; ISS:YuBioLab.
InterPro; IPR009617; Seipin.
PANTHER; PTHR21212; PTHR21212; 1.
Pfam; PF06775; Seipin; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Congenital generalized lipodystrophy; Diabetes mellitus;
Disease mutation; Endoplasmic reticulum; Glycoprotein;
Hereditary spastic paraplegia; Lipid degradation; Lipid metabolism;
Membrane; Neurodegeneration; Neuropathy; Phosphoprotein;
Reference proteome; Transmembrane; Transmembrane helix.
CHAIN 1 398 Seipin.
/FTId=PRO_0000191679.
TOPO_DOM 1 26 Cytoplasmic. {ECO:0000255}.
TRANSMEM 27 47 Helical. {ECO:0000255}.
TOPO_DOM 48 242 Lumenal. {ECO:0000255}.
TRANSMEM 243 263 Helical. {ECO:0000255}.
TOPO_DOM 264 398 Cytoplasmic. {ECO:0000255}.
MOD_RES 289 289 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 346 346 Phosphoserine.
{ECO:0000250|UniProtKB:Q5FVJ6}.
MOD_RES 351 351 Phosphoserine.
{ECO:0000250|UniProtKB:Q5FVJ6}.
MOD_RES 372 372 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
CARBOHYD 88 88 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:14981520}.
CARBOHYD 242 242 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 1 M -> MSTEKVDQKEEAGEKEVCGDQIKGPDKEEEPPAAAS
HGQGWRPGGRAARNARPEPGARHPALPAM (in isoform
3). {ECO:0000305}.
/FTId=VSP_044545.
VAR_SEQ 225 287 YLLYNFPMTCAFIGVASNFTFLSVIVLFSYMQWVWGGIWPR
HRFSLQVNIRKRDNSRKEVQRR -> LTSEKETIPGRKSNE
GSLLISQGLKARRSQLRNQMLQRMVRALKIPQGQRVSCPRR
RNQISSP (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_051726.
VAR_SEQ 288 398 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_051727.
VARIANT 88 88 N -> S (in SPG17 and HMN5A; does not
affect protein subcellular location;
dbSNP:rs137852972).
{ECO:0000269|PubMed:14981520,
ECO:0000269|PubMed:17663003,
ECO:0000269|PubMed:18585921}.
/FTId=VAR_022375.
VARIANT 90 90 S -> L (in SPG17 and HMN5A; also found in
patients with hereditary motor and
sensory neuropathy type 2; does not
affect the function in lipid storage;
dbSNP:rs137852973).
{ECO:0000269|PubMed:14981520,
ECO:0000269|PubMed:17663003,
ECO:0000269|PubMed:21533227,
ECO:0000269|PubMed:24604904}.
/FTId=VAR_022376.
VARIANT 212 212 A -> P (in CGL2; increases localization
to nuclear envelope; dbSNP:rs137852971).
{ECO:0000269|PubMed:11479539,
ECO:0000269|PubMed:18458148}.
/FTId=VAR_022377.
SEQUENCE 398 AA; 44392 MW; 9FB1B37E72493DB9 CRC64;
MVNDPPVPAL LWAQEVGQVL AGRARRLLLQ FGVLFCTILL LLWVSVFLYG SFYYSYMPTV
SHLSPVHFYY RTDCDSSTTS LCSFPVANVS LTKGGRDRVL MYGQPYRVTL ELELPESPVN
QDLGMFLVTI SCYTRGGRII STSSRSVMLH YRSDLLQMLD TLVFSSLLLF GFAEQKQLLE
VELYADYREN SYVPTTGAII EIHSKRIQLY GAYLRIHAHF TGLRYLLYNF PMTCAFIGVA
SNFTFLSVIV LFSYMQWVWG GIWPRHRFSL QVNIRKRDNS RKEVQRRISA HQPGPEGQEE
STPQSDVTED GESPEDPSGT EGQLSEEEKP DQQPLSGEEE LEPEASDGSG SWEDAALLTE
ANLPAPAPAS ASAPVLETLG SSEPAGGALR QRPTCSSS


Related products :

Catalog number Product name Quantity
CSB-EL002829RA Rat Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2) ELISA kit, Species Rat, Sample Type serum, plasma 96T
CSB-EL002829BO Bovine Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2) ELISA kit, Species Bovine, Sample Type serum, plasma 96T
CSB-EL002829HU Human Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL002829MO Mouse Bernardinelli-Seip congenital lipodystrophy 2 (seipin) (BSCL2) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
BSG BSCL2 Gene Berardinelli-Seip congenital lipodystrophy 2 (seipin)
E14590h Human Berardinelli Seip Congenital Lipodystrophy 2 96T
ABP-PAB-10673 Fukuyama type congenital muscular dystrophy protein (FCMD) polyclonal antibody 100 ug
30-876 LCA5 is a protein that is thought to be involved in centrosomal or ciliary functions. Mutations in this gene cause Leber congenital amaurosis type V. This gene encodes a protein that is thought to be 0.05 mg
CD101 CCV Gene cataract, congenital, Volkmann type
E5538h Human Congenital Dyserythropoietic Anemia Type II 96T
P3131Rb Rabbit anti_ Fukuyama type congenital muscular dys 40ug/0.2ml
CCAR1 CCA1 Gene cataract, congenital, cerulean type, 1
CDB2 CDAN1 Gene congenital dyserythropoietic anemia, type I
CDC123 CDAN3 Gene congenital dyserythropoietic anemia, type III
201-20-0952 CDAN1{congenital dyserythropoietic anemia, type I}rabbit.pAb 0.1ml
CSB-EL004978MO Mouse congenital dyserythropoietic anemia, type I (CDAN1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL004978HU Human congenital dyserythropoietic anemia, type I (CDAN1) ELISA kit, Species Human, Sample Type serum, plasma 96T
ABP-PAB-10915 Nephrosis 1 of the congenital Finnish type (NPHS1) polyclonal antibody 100 ug
E13812068 Nephrosis 1, Congenital, Finnish Type (Nephrin) (NPHS1) ELISA Kit 1
NPIP NPHS1 Gene nephrosis 1, congenital, Finnish type (nephrin)
abx116797 Polyclonal Rabbit Congenital Dyserythropoietic Anemia, Type I Antibody 50 μl
CSB-EL015988MO Mouse nephrosis 1, congenital, Finnish type (nephrin) (NPHS1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL012781RA Rat Leber congenital amaurosis 5 (LCA5) ELISA kit, Species Rat, Sample Type serum, plasma 96T
EIAAB46442 CHD5,Congenital heart disease 5 protein,Homo sapiens,Human,Tryptophan-rich protein,WRB
EIAAB27179 Congenital cataracts and dental anomalies protein,Homo sapiens,Human,Nance-Horan syndrome protein,NHS


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: +49 0241 40 08 90 86, +49 0241 95 78 94 78, +49 0241 40 08 90 86
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur