Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Serine/threonine-protein kinase DCLK2 (EC 2.7.11.1) (CaMK-like CREB regulatory kinase 2) (CL2) (CLICK-II) (CLICK2) (Doublecortin-like and CAM kinase-like 2) (Doublecortin-like kinase 2)

 DCLK2_MOUSE             Reviewed;         756 AA.
Q6PGN3; Q1EDG7; Q1EDG8; Q4H483; Q4W8V1; Q8BUU0; Q8BX25;
15-FEB-2005, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
22-NOV-2017, entry version 127.
RecName: Full=Serine/threonine-protein kinase DCLK2;
EC=2.7.11.1;
AltName: Full=CaMK-like CREB regulatory kinase 2;
Short=CL2;
Short=CLICK-II;
Short=CLICK2;
AltName: Full=Doublecortin-like and CAM kinase-like 2;
AltName: Full=Doublecortin-like kinase 2;
Name=Dclk2; Synonyms=Dcamkl2;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3; 4 AND 5), FUNCTION,
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, AND
MUTAGENESIS OF LYS-422.
STRAIN=ICR; TISSUE=Brain;
PubMed=16684769; DOI=10.1074/jbc.M513212200;
Ohmae S., Takemoto-Kimura S., Okamura M., Adachi-Morishima A.,
Nonaka M., Fuse T., Kida S., Tanji M., Furuyashiki T., Arakawa Y.,
Narumiya S., Okuno H., Bito H.;
"Molecular identification and characterization of a family of kinases
with homology to Ca2+/calmodulin-dependent protein kinases I/IV.";
J. Biol. Chem. 281:20427-20439(2006).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
TISSUE=Brain;
Shimomura S., Nagamine T., Sueyoshi N., Kameshita I.;
"Molecular cloning and expression of mouse doublecortin like protein
kinase.";
Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 6).
STRAIN=C57BL/6J; TISSUE=Cerebellum, and Embryonic stem cell;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=C57BL/6J; TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
DEVELOPMENTAL STAGE, TISSUE SPECIFICITY, AND GENE FAMILY.
PubMed=16869982; DOI=10.1186/1471-2164-7-188;
Reiner O., Coquelle F.M., Peter B., Levy T., Kaplan A., Sapir T.,
Orr I., Barkai N., Eichele G., Bergmann S.;
"The evolving doublecortin (DCX) superfamily.";
BMC Genomics 7:188-188(2006).
[6]
SUBCELLULAR LOCATION, AND INTERACTION WITH MAPK8IP1; MAPK8IP2; MAPK9;
PPP1R9B AND ACTIN.
PubMed=16628014; DOI=10.4161/cc.5.9.2715;
Coquelle F.M., Levy T., Bergmann S., Wolf S.G., Bar-El D., Sapir T.,
Brody Y., Orr I., Barkai N., Eichele G., Reiner O.;
"Common and divergent roles for members of the mouse DCX
superfamily.";
Cell Cycle 5:976-983(2006).
[7]
TISSUE SPECIFICITY, AND DEVELOPMENTAL STAGE.
PubMed=18075264; DOI=10.1159/000109861;
Tuy F.P.D., Saillour Y., Kappeler C., Chelly J., Francis F.;
"Alternative transcripts of Dclk1 and Dclk2 and their expression in
doublecortin knockout mice.";
Dev. Neurosci. 30:171-186(2008).
[8]
DISRUPTION PHENOTYPE, AND TISSUE SPECIFICITY.
PubMed=19342486; DOI=10.1073/pnas.0812687106;
Kerjan G., Koizumi H., Han E.B., Dube C.M., Djakovic S.N.,
Patrick G.N., Baram T.Z., Heinemann S.F., Gleeson J.G.;
"Mice lacking doublecortin and doublecortin-like kinase 2 display
altered hippocampal neuronal maturation and spontaneous seizures.";
Proc. Natl. Acad. Sci. U.S.A. 106:6766-6771(2009).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
[10]
REVIEW, AND GENE FAMILY.
PubMed=20236041; DOI=10.2174/187152410790780118;
Dijkmans T.F., van Hooijdonk L.W.A., Fitzsimons C.P., Vreugdenhil E.;
"The doublecortin gene family and disorders of neuronal structure.";
Cent. Nerv. Syst. Agents Med. Chem. 10:32-46(2010).
-!- FUNCTION: Protein kinase with a significantly reduced Ca(2+)+/CAM
affinity and dependence compared to other members of the CaMK
family. May play a role in the down-regulation of CRE-dependent
gene activation probably by phosphorylation of the CREB
coactivator CRTC2/TORC2 and the resulting retention of TORC2 in
the cytoplasm. {ECO:0000269|PubMed:16684769}.
-!- CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
-!- SUBUNIT: Binds to and stabilizes microtubules (By similarity).
Interacts with MAPK8IP1/JIP-1, MAPK8IP2/JIP-2, MAPK9/JNK2,
PPP1R9B/NEURABIN-2 and actin. {ECO:0000250,
ECO:0000269|PubMed:16628014}.
-!- SUBCELLULAR LOCATION: Cytoplasm, cytoskeleton
{ECO:0000269|PubMed:16628014, ECO:0000269|PubMed:16684769}.
Note=Colocalizes with microtubules.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1;
IsoId=Q6PGN3-1; Sequence=Displayed;
Name=2;
IsoId=Q6PGN3-2; Sequence=VSP_012797;
Name=3; Synonyms=alpha;
IsoId=Q6PGN3-3; Sequence=VSP_038892, VSP_012797;
Name=4; Synonyms=beta1;
IsoId=Q6PGN3-4; Sequence=VSP_038892, VSP_038895, VSP_038896;
Note=No experimental confirmation available.;
Name=5; Synonyms=beta2;
IsoId=Q6PGN3-5; Sequence=VSP_038892, VSP_012797, VSP_038895,
VSP_038896;
Note=No experimental confirmation available.;
Name=6;
IsoId=Q6PGN3-6; Sequence=VSP_038893, VSP_038894;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in the central and peripheral
nervous system including the brain, spinal cord, cranial and
dorsal root ganglia and in the parasympathetic ganglia. Present in
neurons, but not in glial cells, in most forebrain areas. Strong
expression in the hippocampal CA1 pyramidal cell layer. Expressed
in the photoreceptor sensory cilium complex and in eyes. Also
detected in individual cells of the olfactory epithelium.
{ECO:0000269|PubMed:16684769, ECO:0000269|PubMed:16869982,
ECO:0000269|PubMed:18075264, ECO:0000269|PubMed:19342486}.
-!- DEVELOPMENTAL STAGE: At 17.5 dpc, predominantly expressed in the
central nervous system, throughout the forebrain, midbrain,
hindbrain, and the spinal cord. Expressed in the developing
neocortex and at low levels in the ventricular zone, especially in
the outer neuroblastic layer. In the developing retina, strongly
expressed in the postmitotic inner neuroblastic layer. Also found
in the developing ovary and, to a lower extent, throughout the
kidney. {ECO:0000269|PubMed:16684769, ECO:0000269|PubMed:16869982,
ECO:0000269|PubMed:18075264}.
-!- DOMAIN: The doublecortin domains are involved in the
colocalization with microtubules.
-!- PTM: Autophosphorylated. {ECO:0000250}.
-!- DISRUPTION PHENOTYPE: Frequent spontaneous seizures that originate
in the hippocampus, with most animals dying in the first few
months of life. {ECO:0000269|PubMed:19342486}.
-!- SIMILARITY: Belongs to the protein kinase superfamily. CAMK
Ser/Thr protein kinase family. CaMK subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY968049; AAY40243.1; -; mRNA.
EMBL; AY968050; AAY40244.1; -; mRNA.
EMBL; AY968051; AAY40245.1; -; mRNA.
EMBL; AB198721; BAE06836.1; -; mRNA.
EMBL; AK049179; BAC33590.1; -; mRNA.
EMBL; AK082633; BAC38555.1; -; mRNA.
EMBL; BC056921; AAH56921.1; -; mRNA.
CCDS; CCDS17448.1; -. [Q6PGN3-1]
CCDS; CCDS79936.1; -. [Q6PGN3-2]
RefSeq; NP_001182425.1; NM_001195496.1. [Q6PGN3-3]
RefSeq; NP_001182426.1; NM_001195497.1. [Q6PGN3-2]
RefSeq; NP_001182427.1; NM_001195498.1. [Q6PGN3-4]
RefSeq; NP_001182428.1; NM_001195499.1. [Q6PGN3-5]
RefSeq; NP_081815.3; NM_027539.5. [Q6PGN3-1]
UniGene; Mm.44490; -.
ProteinModelPortal; Q6PGN3; -.
SMR; Q6PGN3; -.
BioGrid; 214240; 2.
STRING; 10090.ENSMUSP00000029719; -.
iPTMnet; Q6PGN3; -.
PhosphoSitePlus; Q6PGN3; -.
PaxDb; Q6PGN3; -.
PeptideAtlas; Q6PGN3; -.
PRIDE; Q6PGN3; -.
DNASU; 70762; -.
Ensembl; ENSMUST00000029719; ENSMUSP00000029719; ENSMUSG00000028078. [Q6PGN3-1]
Ensembl; ENSMUST00000191752; ENSMUSP00000141707; ENSMUSG00000028078. [Q6PGN3-6]
Ensembl; ENSMUST00000195561; ENSMUSP00000142267; ENSMUSG00000028078. [Q6PGN3-2]
GeneID; 70762; -.
KEGG; mmu:70762; -.
UCSC; uc008prl.3; mouse. [Q6PGN3-1]
UCSC; uc008prm.3; mouse. [Q6PGN3-5]
UCSC; uc008prn.3; mouse. [Q6PGN3-4]
UCSC; uc008pro.3; mouse. [Q6PGN3-3]
UCSC; uc008prp.3; mouse. [Q6PGN3-2]
UCSC; uc008prq.3; mouse. [Q6PGN3-6]
CTD; 166614; -.
MGI; MGI:1918012; Dclk2.
eggNOG; KOG0032; Eukaryota.
eggNOG; KOG3757; Eukaryota.
eggNOG; ENOG410YA63; LUCA.
GeneTree; ENSGT00840000129744; -.
HOVERGEN; HBG003790; -.
InParanoid; Q6PGN3; -.
KO; K08805; -.
OMA; ERAGTWR; -.
OrthoDB; EOG091G02RF; -.
PhylomeDB; Q6PGN3; -.
TreeFam; TF318770; -.
PRO; PR:Q6PGN3; -.
Proteomes; UP000000589; Chromosome 3.
Bgee; ENSMUSG00000028078; -.
CleanEx; MM_DCLK2; -.
ExpressionAtlas; Q6PGN3; baseline and differential.
Genevisible; Q6PGN3; MM.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
GO; GO:0005856; C:cytoskeleton; IEA:UniProtKB-SubCell.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0004672; F:protein kinase activity; IDA:MGI.
GO; GO:0004674; F:protein serine/threonine kinase activity; IBA:GO_Central.
GO; GO:0021766; P:hippocampus development; IGI:MGI.
GO; GO:0035556; P:intracellular signal transduction; IBA:GO_Central.
GO; GO:0000226; P:microtubule cytoskeleton organization; IDA:MGI.
GO; GO:1900181; P:negative regulation of protein localization to nucleus; IDA:MGI.
GO; GO:0018105; P:peptidyl-serine phosphorylation; IDA:MGI.
GO; GO:0018107; P:peptidyl-threonine phosphorylation; IBA:GO_Central.
GO; GO:0021860; P:pyramidal neuron development; IGI:MGI.
CDD; cd01617; DCX; 2.
Gene3D; 3.10.20.230; -; 2.
InterPro; IPR003533; Doublecortin_dom.
InterPro; IPR036572; Doublecortin_dom_sf.
InterPro; IPR011009; Kinase-like_dom_sf.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR017441; Protein_kinase_ATP_BS.
InterPro; IPR008271; Ser/Thr_kinase_AS.
Pfam; PF03607; DCX; 2.
Pfam; PF00069; Pkinase; 1.
SMART; SM00537; DCX; 2.
SMART; SM00220; S_TKc; 1.
SUPFAM; SSF56112; SSF56112; 1.
SUPFAM; SSF89837; SSF89837; 2.
PROSITE; PS50309; DC; 2.
PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
PROSITE; PS00108; PROTEIN_KINASE_ST; 1.
1: Evidence at protein level;
Alternative splicing; ATP-binding; Complete proteome; Cytoplasm;
Cytoskeleton; Kinase; Nucleotide-binding; Phosphoprotein;
Reference proteome; Repeat; Serine/threonine-protein kinase;
Transferase.
CHAIN 1 756 Serine/threonine-protein kinase DCLK2.
/FTId=PRO_0000085923.
DOMAIN 72 158 Doublecortin 1. {ECO:0000255|PROSITE-
ProRule:PRU00072}.
DOMAIN 196 279 Doublecortin 2. {ECO:0000255|PROSITE-
ProRule:PRU00072}.
DOMAIN 393 650 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
NP_BIND 399 407 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
COMPBIAS 292 361 Ser-rich.
COMPBIAS 719 740 Pro-rich.
ACT_SITE 514 514 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159, ECO:0000255|PROSITE-
ProRule:PRU10027}.
BINDING 422 422 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
MOD_RES 61 61 Phosphothreonine.
{ECO:0000250|UniProtKB:Q8N568}.
MOD_RES 361 361 Phosphoserine.
{ECO:0000250|UniProtKB:Q8N568}.
MOD_RES 646 646 Phosphoserine.
{ECO:0000250|UniProtKB:Q5MPA9}.
MOD_RES 665 665 Phosphothreonine.
{ECO:0000250|UniProtKB:Q5MPA9}.
VAR_SEQ 320 320 V -> VKRAGHSSAYSTAKSPV (in isoform 3,
isoform 4 and isoform 5).
{ECO:0000303|PubMed:16684769,
ECO:0000303|Ref.2}.
/FTId=VSP_038892.
VAR_SEQ 352 352 Missing (in isoform 2, isoform 3 and
isoform 5). {ECO:0000303|PubMed:16141072,
ECO:0000303|PubMed:16684769,
ECO:0000303|Ref.2}.
/FTId=VSP_012797.
VAR_SEQ 625 651 Missing (in isoform 6).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_038893.
VAR_SEQ 691 756 NTALDKEGQIFCSKLCQDSSRPSREQTSPVPPSAQEAPPPL
ESPRPPGPPATSGCDLAGTWRRHRD -> VSGTQSSASESR
GWPSWSCCLDSQGSAHGSWCLPCSCLHGGLPGM (in
isoform 6).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_038894.
VAR_SEQ 691 699 NTALDKEGQ -> VQGHEHGSR (in isoform 4 and
isoform 5).
{ECO:0000303|PubMed:16684769}.
/FTId=VSP_038895.
VAR_SEQ 700 756 Missing (in isoform 4 and isoform 5).
{ECO:0000303|PubMed:16684769}.
/FTId=VSP_038896.
MUTAGEN 422 422 K->A: Loss of kinase activity. No effect
on colocalization with microtubules.
{ECO:0000269|PubMed:16684769}.
CONFLICT 33 33 G -> D (in Ref. 1; AAY40245).
{ECO:0000305}.
SEQUENCE 756 AA; 82979 MW; C658F0999547B779 CRC64;
MASTRSIELE HFEERDKRPR PGSRRGAPSS SGGSSISGPK GNGLIPSPAH SAHCSFYRTR
TLQALSSEKK AKKARFYRNG DRYFKGLVFA ISNDRFRSFD ALLIELTRSL SDNVNLPQGV
RTIYTIDGSR KVTSLDELLE GESYVCASNE PFRKVDYTKN VNPNWSVNIK GGTTRTLAVA
SAKSEVKESK DFIKPKLVTV IRSGVKPRKA VRILLNKKTA HSFEQVLTDI TEAIKLDSGV
VKRLCTLDGK QVTCLQDFFG DDDVFIACGP EKYRYAQDDF VLDHSECRVL KSSYSRASAA
KYSGSRSPGF SRRSKSPASV NGTPSSQLST PKSTKSSSSS PTSPGSFRGL KQISAQGRSS
SNVNGGPELD RCLSPEGVNG NRCSESFPLL EKYRIGKVIG DGNFAVVKEC VDRYTGKEFA
LKIIDKAKCC GKEHLIENEV SILRRVKHPN IIMLVEEMET ATDLFLVMEL VKGGDLFDAI
TSSTKYTERD GSAMVYNLAN ALRYLHSLSI VHRDIKPENL LVCEYPDGTK SLKLGDFGLA
TVVEGPLYTV CGTPTYVAPE IIAETGYGLK VDVWAAGVIT YILLCGFPPF RSENNLQEDL
FDQILAGKLE FPAPYWDNIT DSAKELISQM LQVNVEARCT AGEILSHPWV SDDASQENNM
QAEVTGKLKQ HFNNALPKQN STTTGVSVIM NTALDKEGQI FCSKLCQDSS RPSREQTSPV
PPSAQEAPPP LESPRPPGPP ATSGCDLAGT WRRHRD


Related products :

Catalog number Product name Quantity
EIAAB10608 CaMK-like CREB regulatory kinase 2,CL2,CLICK2,CLICK-II,Dcamkl2,Dck2,Dclk2,Doublecortin-like and CAM kinase-like 2,Doublecortin-like kinase 2,Rat,Rattus norvegicus,Serine_threonine-protein kinase DCLK2
EIAAB10609 CaMK-like CREB regulatory kinase 2,CL2,CLICK2,CLICK-II,Dcamkl2,Dclk2,Doublecortin-like and CAM kinase-like 2,Doublecortin-like kinase 2,Mouse,Mus musculus,Serine_threonine-protein kinase DCLK2
EIAAB10607 CaMK-like CREB regulatory kinase 2,CL2,CLICK2,CLICK-II,DCAMKL2,DCDC3B,DCK2,DCLK2,Doublecortin domain-containing protein 3B,Doublecortin-like and CAM kinase-like 2,Doublecortin-like kinase 2,Homo sapie
EIAAB10611 CLICK-I and II-related,CLr,Dcamkl3,Dclk3,Doublecortin-like and CAM kinase-like 3,Doublecortin-like kinase 3,Mouse,Mus musculus,Serine_threonine-protein kinase DCLK3
EIAAB10610 DCAMKL3,DCDC3C,DCLK3,Doublecortin domain-containing protein 3C,Doublecortin-like and CAM kinase-like 3,Doublecortin-like kinase 3,Homo sapiens,Human,KIAA1765,Serine_threonine-protein kinase DCLK3
EIAAB10606 DCAMKL1,DCDC3A,DCLK1,Doublecortin domain-containing protein 3A,Doublecortin-like and CAM kinase-like 1,Doublecortin-like kinase 1,Homo sapiens,Human,KIAA0369,Serine_threonine-protein kinase DCLK1
EIAAB10605 Calcium_calmodulin-dependent protein kinase type I-like CPG16,Cpg16,Dcamkl1,Dclk1,Doublecortin-like and CAM kinase-like 1,Doublecortin-like kinase 1,Rat,Rattus norvegicus,Serine_threonine-protein kina
EIAAB10604 Dcamkl1,Dclk,Dclk1,Doublecortin-like and CAM kinase-like 1,Doublecortin-like kinase 1,Mouse,Mus musculus,Serine_threonine-protein kinase DCLK1
10-782-55018 Calcium_calmodulin-dependent protein kinase type 1G - EC 2.7.11.17; CaM kinase IG; CaM kinase I gamma; CaMKI gamma; CaMKI-gamma; CaM-KI gamma; CaMKIG; CaMK-like CREB kinase III; CLICK III N_A 0.001 mg
10-782-55018 Calcium_calmodulin-dependent protein kinase type 1G - EC 2.7.11.17; CaM kinase IG; CaM kinase I gamma; CaMKI gamma; CaMKI-gamma; CaM-KI gamma; CaMKIG; CaMK-like CREB kinase III; CLICK III N_A 0.005 mg
10-782-55018 Calcium_calmodulin-dependent protein kinase type 1G - EC 2.7.11.17; CaM kinase IG; CaM kinase I gamma; CaMKI gamma; CaMKI-gamma; CaM-KI gamma; CaMKIG; CaMK-like CREB kinase III; CLICK III N_A 0.02 mg
10-782-55018 Calcium_calmodulin-dependent protein kinase type 1G - EC 2.7.11.17; CaM kinase IG; CaM kinase I gamma; CaMKI gamma; CaMKI-gamma; CaM-KI gamma; CaMKIG; CaMK-like CREB kinase III; CLICK III N_A 0.01 mg
EIAAB31334 Bos taurus,Bovine,PKN,PKN1,PRK1,PRKCL1,Protein kinase C-like 1,Protein kinase C-like PKN,Protein kinase PKN-alpha,Protein-kinase C-related kinase 1,Serine_threonine-protein kinase N1,Serine-threonine
EIAAB31332 Mouse,Mus musculus,Pkn,Pkn1,Prk1,Prkcl1,Protein kinase C-like 1,Protein kinase C-like PKN,Protein-kinase C-related kinase 1,Serine_threonine-protein kinase N1,Serine-threonine protein kinase N
EIAAB24783 GCK family kinase MiNK,Map4k6,MAPK_ERK kinase kinase kinase 6,MEK kinase kinase 6,MEKKK 6,Mink,Mink1,Misshapen_NIK-related kinase,Misshapen-like kinase 1,Mitogen-activated protein kinase kinase kinase
EIAAB24784 GCK family kinase MiNK,Map4k6,MAPK_ERK kinase kinase kinase 6,MEK kinase kinase 6,MEKKK 6,Mink,Mink1,Misshapen_NIK-related kinase,Misshapen-like kinase 1,Mitogen-activated protein kinase kinase kinase
EIAAB25244 c-Jun N-terminal kinase kinase 2,Dual specificity mitogen-activated protein kinase kinase 7,JNK kinase 2,JNK-activating kinase 2,JNKK 2,MAP kinase kinase 7,Map2k7,MAPK_ERK kinase 7,MAPKK 7,MEK 7,Mkk7,
EIAAB25239 C-JUN N-terminal kinase kinase 1,Dual specificity mitogen-activated protein kinase kinase 4,JNK kinase 1,JNK-activating kinase 1,JNKK 1,Jnkk1,MAP kinase kinase 4,Map2k4,MAPK_ERK kinase 4,MAPKK 4,MEK 4
G9882 Serine threonine-protein kinase DCLK2 (DCLK2), Human, ELISA Kit 96T
G9883 Serine threonine-protein kinase DCLK2 (DCLK2), Mouse, ELISA Kit 96T
EIAAB25245 c-Jun N-terminal kinase kinase 2,Dual specificity mitogen-activated protein kinase kinase 7,JNK kinase 2,JNK-activating kinase 2,JNKK 2,MAP kinase kinase 7,Map2k7,MAPK_ERK kinase 7,MAPKK 7,MEK 7,Rat,R
G9884 Serine threonine-protein kinase DCLK2 (DCLK2), Rat, ELISA Kit 96T
DCLK2_RAT ELISA Kit FOR Serine per threonine-protein kinase DCLK2; organism: Rat; gene name: Dclk2 96T
DCLK2_MOUSE ELISA Kit FOR Serine per threonine-protein kinase DCLK2; organism: Mouse; gene name: Dclk2 96T
DCLRE1A DCLK2 Gene doublecortin-like kinase 2


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur