Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Serologically defined colon cancer antigen 3 homolog

 SDCG3_MOUSE             Reviewed;         432 AA.
A2AIW0; A2AIW1; Q3TQC5; Q6P8W2; Q8BIV5; Q8K0I8; Q9D1V2; Q9D4S1;
Q9D5W1;
18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
20-FEB-2007, sequence version 1.
18-JUL-2018, entry version 79.
RecName: Full=Serologically defined colon cancer antigen 3 homolog;
Name=Sdccag3;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3; 4 AND 5).
STRAIN=C57BL/6J; TISSUE=Cerebellum, Hippocampus, and Testis;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 6).
STRAIN=FVB/N; TISSUE=Brain, and Kidney;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=16332174; DOI=10.1089/dna.2005.24.777;
Neznanov N., Neznanova L., Angres B., Gudkov A.V.;
"Serologically defined colon cancer antigen 3 is necessary for the
presentation of TNF receptor 1 on cell surface.";
DNA Cell Biol. 24:777-785(2005).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-241 AND SER-245,
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-18 (ISOFORM 3), AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain, Kidney, Lung, Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: May be involved in modulation of TNF response. May be
involved in presentation of TNFRSF1A on the cell surface
(PubMed:16332174). Involved in the endosome-to-plasma membrane
trafficking and recycling of SNX27-retromer-dependent cargo
proteins, such as GLUT1. Involved in the regulation of
cytokinesis; the function may involve PTPN13 and GIT1 (By
similarity). {ECO:0000250|UniProtKB:Q96C92,
ECO:0000269|PubMed:16332174}.
-!- SUBUNIT: Interacts with PTPN13, GIT1, VPS35 (By similarity).
{ECO:0000250|UniProtKB:Q96C92}.
-!- SUBCELLULAR LOCATION: Midbody {ECO:0000250|UniProtKB:Q96C92}.
Early endosome {ECO:0000250|UniProtKB:Q96C92}. Recycling endosome
{ECO:0000250|UniProtKB:Q96C92}. Cytoplasm
{ECO:0000269|PubMed:16332174}. Note=During cytokinesis colocalized
with PTPN13 at the midbody. Colocalizes in a WASHC2-dependent
manner with the retromer CSC complex at endosomes (By similarity).
{ECO:0000250|UniProtKB:Q96C92}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=6;
Name=1;
IsoId=A2AIW0-1; Sequence=Displayed;
Name=2;
IsoId=A2AIW0-2; Sequence=VSP_032180;
Name=3;
IsoId=A2AIW0-3; Sequence=VSP_032179;
Note=Contains a phosphoserine at position 18.
{ECO:0000244|PubMed:21183079};
Name=4;
IsoId=A2AIW0-4; Sequence=VSP_032178;
Name=5;
IsoId=A2AIW0-5; Sequence=VSP_032183;
Name=6;
IsoId=A2AIW0-6; Sequence=VSP_032180, VSP_032181, VSP_032182;
Note=No experimental confirmation available.;
-!- SIMILARITY: Belongs to the SDCCAG3 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAB30158.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=BAB32357.1; Type=Frameshift; Positions=263; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK082787; BAC38620.1; -; mRNA.
EMBL; AK016227; BAB30158.1; ALT_INIT; mRNA.
EMBL; AK021273; BAB32357.1; ALT_FRAME; mRNA.
EMBL; AK014885; BAB29602.1; -; mRNA.
EMBL; AK163690; BAE37459.1; -; mRNA.
EMBL; AL732541; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC031199; AAH31199.1; -; mRNA.
EMBL; BC061037; AAH61037.1; -; mRNA.
CCDS; CCDS15803.2; -. [A2AIW0-1]
CCDS; CCDS50540.1; -. [A2AIW0-3]
CCDS; CCDS50541.1; -. [A2AIW0-2]
RefSeq; NP_001078876.1; NM_001085407.1. [A2AIW0-2]
RefSeq; NP_001078877.1; NM_001085408.1. [A2AIW0-3]
RefSeq; NP_080839.2; NM_026563.3. [A2AIW0-1]
UniGene; Mm.253771; -.
ProteinModelPortal; A2AIW0; -.
SMR; A2AIW0; -.
STRING; 10090.ENSMUSP00000109737; -.
iPTMnet; A2AIW0; -.
PhosphoSitePlus; A2AIW0; -.
MaxQB; A2AIW0; -.
PaxDb; A2AIW0; -.
PRIDE; A2AIW0; -.
Ensembl; ENSMUST00000028293; ENSMUSP00000028293; ENSMUSG00000026927. [A2AIW0-2]
Ensembl; ENSMUST00000077983; ENSMUSP00000077133; ENSMUSG00000026927. [A2AIW0-3]
Ensembl; ENSMUST00000114102; ENSMUSP00000109737; ENSMUSG00000026927. [A2AIW0-1]
GeneID; 68112; -.
KEGG; mmu:68112; -.
UCSC; uc008iuy.1; mouse. [A2AIW0-1]
UCSC; uc008iuz.1; mouse. [A2AIW0-2]
UCSC; uc008iva.1; mouse. [A2AIW0-3]
UCSC; uc008ivb.1; mouse. [A2AIW0-5]
UCSC; uc008ivc.1; mouse. [A2AIW0-6]
CTD; 68112; -.
MGI; MGI:1915362; Sdccag3.
eggNOG; ENOG410IHIY; Eukaryota.
eggNOG; ENOG4111TAC; LUCA.
GeneTree; ENSGT00390000000560; -.
HOVERGEN; HBG058095; -.
InParanoid; A2AIW0; -.
OMA; IRPAFMC; -.
OrthoDB; EOG091G0JQ8; -.
PhylomeDB; A2AIW0; -.
TreeFam; TF335840; -.
ChiTaRS; Sdccag3; mouse.
PRO; PR:A2AIW0; -.
Proteomes; UP000000589; Chromosome 2.
Bgee; ENSMUSG00000026927; -.
CleanEx; MM_SDCCAG3; -.
ExpressionAtlas; A2AIW0; baseline and differential.
Genevisible; A2AIW0; MM.
GO; GO:0005769; C:early endosome; ISO:MGI.
GO; GO:0005768; C:endosome; ISO:MGI.
GO; GO:0030496; C:midbody; ISO:MGI.
GO; GO:0055037; C:recycling endosome; ISO:MGI.
GO; GO:0030904; C:retromer complex; IEA:Ensembl.
GO; GO:0007049; P:cell cycle; IEA:UniProtKB-KW.
GO; GO:0051301; P:cell division; IEA:UniProtKB-KW.
GO; GO:0015031; P:protein transport; IEA:UniProtKB-KW.
GO; GO:0032465; P:regulation of cytokinesis; ISO:MGI.
GO; GO:1990126; P:retrograde transport, endosome to plasma membrane; ISO:MGI.
InterPro; IPR026757; SDCCAG3.
PANTHER; PTHR31259; PTHR31259; 1.
1: Evidence at protein level;
Alternative splicing; Cell cycle; Cell division; Coiled coil;
Complete proteome; Cytoplasm; Endosome; Phosphoprotein;
Protein transport; Reference proteome; Transport.
CHAIN 1 432 Serologically defined colon cancer
antigen 3 homolog.
/FTId=PRO_0000324286.
REGION 174 196 Required for interaction with PTPN13.
{ECO:0000250|UniProtKB:Q96C92}.
COILED 262 289 {ECO:0000255}.
COILED 315 370 {ECO:0000255}.
MOD_RES 18 18 Phosphoserine.
{ECO:0000250|UniProtKB:Q96C92}.
MOD_RES 148 148 Phosphoserine.
{ECO:0000250|UniProtKB:Q96C92}.
MOD_RES 241 241 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 245 245 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
VAR_SEQ 1 58 Missing (in isoform 4).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_032178.
VAR_SEQ 24 96 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:16141072}.
/FTId=VSP_032179.
VAR_SEQ 24 73 Missing (in isoform 2 and isoform 6).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:16141072}.
/FTId=VSP_032180.
VAR_SEQ 136 143 EASRHPLG -> VHLGSCQW (in isoform 6).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_032181.
VAR_SEQ 144 432 Missing (in isoform 6).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_032182.
VAR_SEQ 272 432 LKDENSKLRRKLNEVQSFSETQTEMVRTLERKLEAKMIKEE
SDFHDLESVVQQVEQNLELMTKRAVKAENHVLKLKQEINLL
QAQLSNLRRENEALRSGQGASLSVVKQNTDVALQNLHLVMN
SAHASIKQLVSGADTLNLVAEILKSIDRISEVKDEVDS ->
VSEGSVAPNTAELCCGEELQSSTSWVAWAQCHGQGS (in
isoform 5).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_032183.
CONFLICT 173 173 N -> D (in Ref. 1; BAE37459).
{ECO:0000305}.
CONFLICT 183 183 N -> Y (in Ref. 1; BAB29602).
{ECO:0000305}.
CONFLICT 233 233 T -> P (in Ref. 1; BAB32357).
{ECO:0000305}.
CONFLICT 375 375 L -> V (in Ref. 1; BAB30158).
{ECO:0000305}.
SEQUENCE 432 AA; 48025 MW; 7BFEF3179D254C9A CRC64;
MSGYARRQGA PPLSRTRSLV VPDAPAFYER RSCLPQLDCE RPHGGDLHPH LFGFRPTFMC
YVPSPVLASV GDTGFGYGKG KCTNQGPSGA PETRFGGDKL EDLEEANPFS FKEFLKTKNL
SLSKEDTTTS RIYPKEASRH PLGLEHSSPA SQLMGYGLES QQPFFEDPTR ASNLEEDEDD
GWNITYLPSA VDQTHSSRDT QDSPPCDTYL SFFSNSSELA CPESLPPWTL SDTDSRISPA
SPAGSPNADF AAHEESLGDR HLRTLQISYE ALKDENSKLR RKLNEVQSFS ETQTEMVRTL
ERKLEAKMIK EESDFHDLES VVQQVEQNLE LMTKRAVKAE NHVLKLKQEI NLLQAQLSNL
RRENEALRSG QGASLSVVKQ NTDVALQNLH LVMNSAHASI KQLVSGADTL NLVAEILKSI
DRISEVKDEV DS


Related products :

Catalog number Product name Quantity
EIAAB37718 Cccap,Centrosomal colon cancer autoantigen protein,mCCCAP,Mouse,Mus musculus,Sdccag8,Serologically defined colon cancer antigen 8 homolog
E1628b ELISA Bos taurus,Bovine,SDCCAG3,Serologically defined colon cancer antigen 3 homolog 96T
U1628m CLIA Mouse,Mus musculus,Sdccag3,Serologically defined colon cancer antigen 3 homolog 96T
E1628m ELISA kit Mouse,Mus musculus,Sdccag3,Serologically defined colon cancer antigen 3 homolog 96T
E1628m ELISA Mouse,Mus musculus,Sdccag3,Serologically defined colon cancer antigen 3 homolog 96T
U1628b CLIA Bos taurus,Bovine,SDCCAG3,Serologically defined colon cancer antigen 3 homolog 96T
E1628b ELISA kit Bos taurus,Bovine,SDCCAG3,Serologically defined colon cancer antigen 3 homolog 96T
EIAAB44201 Kiaa4206,Mouse,Mus musculus,Sdccag33,Serologically defined colon cancer antigen 3 homolog,Teashirt homolog 1,Tsh1,Tshz1
E1628m ELISA Kit FOR Serologically defined colon cancer antigen 3 homolog; organism: Mouse; gene name: Sdccag3 96T
SDCG8_MOUSE ELISA Kit FOR Serologically defined colon cancer antigen 8 homolog; organism: Mouse; gene name: Sdccag8 96T
EIAAB44202 Antigen NY-CO-33,Homo sapiens,Human,SDCCAG33,Serologically defined colon cancer antigen 33,Teashirt homolog 1,TSH1,TSHZ1
EIAAB37719 Antigen NY-CO-8,CCCAP,Centrosomal colon cancer autoantigen protein,hCCCAP,Homo sapiens,HSPC085,Human,SDCCAG8,Serologically defined colon cancer antigen 8
EIAAB45482 Antigen NY-CO-16,Homo sapiens,Human,SDCCAG16,Serologically defined colon cancer antigen 16,U3 small nucleolar RNA-associated protein 14 homolog A,UTP14A
E6107h Human Serologically Defined Colon Cancer Antigen 1 96T
E5544h Human Serologically Defined Colon Cancer Antigen 8 96T
EH1858 Serologically defined colon cancer antigen 3 Elisa Kit 96T
E6106h Human Serologically Defined Colon Cancer Antigen 1 96T
EIAAB26930 Mouse,Mus musculus,Nemf,Nuclear export mediator factor Nemf,Sdccag1,Serologically defined colon cancer antigen 1 homolog
201-20-5155 SDCCAG8{serologically defined colon cancer antigen 8}rabbit.pAb 0.2ml
201-20-5154 SDCCAG3{serologically defined colon cancer antigen 3}rabbit.pAb 0.2ml
201-20-5153 SDCCAG10{serologically defined colon cancer antigen 10}rabbit.pAb 0.2ml
EIAAB10039 Antigen NY-CO-10,CWC27,Homo sapiens,Human,Peptidyl-prolyl cis-trans isomerase CWC27 homolog,PPIase CWC27,SDCCAG10,Serologically defined colon cancer antigen 10,UNQ438_PRO871
H0517 Serologically defined colon cancer antigen 3 (SDCCAG3), Bovine, ELISA Kit 96T
H0518 Serologically defined colon cancer antigen 3 (SDCCAG3), Human, ELISA Kit 96T
H0521 Serologically defined colon cancer antigen 8 (SDCCAG8), Mouse, ELISA Kit 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur