Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Serpin A9 (Centerin) (Germinal center B-cell-expressed transcript 1 protein)

 SPA9_HUMAN              Reviewed;         417 AA.
Q86WD7; B4DVH4; B9ZVX3; Q2T9J2; Q6UWP9; Q86WD4; Q86WD5; Q86WD6;
Q86YP6; Q86YP7;
27-SEP-2005, integrated into UniProtKB/Swiss-Prot.
25-NOV-2008, sequence version 3.
25-OCT-2017, entry version 124.
RecName: Full=Serpin A9;
AltName: Full=Centerin;
AltName: Full=Germinal center B-cell-expressed transcript 1 protein;
Flags: Precursor;
Name=SERPINA9; Synonyms=GCET1, SERPINA11; ORFNames=UNQ692/PRO1337;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 5; 6 AND 7), VARIANT ALA-330,
AND TISSUE SPECIFICITY.
PubMed=12819018; DOI=10.1016/S0002-9440(10)63637-1;
Pan Z., Shen Y., Du C., Zhou G., Rosenwald A., Staudt L.M.,
Greiner T.C., McKeithan T.W., Chan W.C.;
"Two newly characterized germinal center B-cell-associated genes,
GCET1 and GCET2, have differential expression in normal and neoplastic
B cells.";
Am. J. Pathol. 163:135-144(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4).
TISSUE=Blood;
Ju S.G., Zhang X.G.;
Submitted (NOV-2002) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANTS
LEU-218; GLN-236; ILE-292 AND ALA-330.
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12508121; DOI=10.1038/nature01348;
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S.,
Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C.,
Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P.,
Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N.,
Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C.,
Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S.,
Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B.,
Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M.,
Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S.,
Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D.,
Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A.,
Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L.,
Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J.,
Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W.,
Quetier F., Waterston R., Hood L., Weissenbach J.;
"The DNA sequence and analysis of human chromosome 14.";
Nature 421:601-607(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
TISSUE=Lymph;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, AND TISSUE SPECIFICITY.
PubMed=17447896; DOI=10.1042/BJ20070174;
Paterson M.A., Horvath A.J., Pike R.N., Coughlin P.B.;
"Molecular characterization of centerin, a germinal centre cell
serpin.";
Biochem. J. 405:489-494(2007).
[8]
TISSUE SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=18550480; DOI=10.1309/9QKE68QU7B825A3U;
Paterson M.A., Hosking P.S., Coughlin P.B.;
"Expression of the serpin centerin defines a germinal center phenotype
in B-cell lymphomas.";
Am. J. Clin. Pathol. 130:117-126(2008).
[9]
TISSUE SPECIFICITY, AND SUBCELLULAR LOCATION.
PubMed=17898315; DOI=10.1182/blood-2007-06-094151;
Montes-Moreno S., Roncador G., Maestre L., Martinez N.,
Sanchez-Verde L., Camacho F.I., Cannata J.,
Martinez-Torrecuadrada J.L., Shen Y., Chan W.C., Piris M.A.;
"Gcet1 (centerin), a highly restricted marker for a subset of germinal
center-derived lymphomas.";
Blood 111:351-358(2008).
-!- FUNCTION: Protease inhibitor that inhibits trypsin and trypsin-
like serine proteases (in vitro). Inhibits plasmin and thrombin
with lower efficiency (in vitro). {ECO:0000269|PubMed:17447896}.
-!- SUBCELLULAR LOCATION: Isoform 1: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 2: Cytoplasm {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 3: Cytoplasm {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 4: Cytoplasm {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 5: Cytoplasm {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 6: Cytoplasm {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 7: Membrane {ECO:0000305}; Single-
pass type II membrane protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1; Synonyms=A;
IsoId=Q86WD7-1; Sequence=Displayed;
Name=2; Synonyms=B;
IsoId=Q86WD7-2; Sequence=VSP_041491, VSP_041493;
Name=3; Synonyms=SERPINA11a;
IsoId=Q86WD7-3; Sequence=VSP_041492;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay. No
experimental confirmation available.;
Name=4; Synonyms=SERPINA11b;
IsoId=Q86WD7-4; Sequence=VSP_041490, VSP_041494, VSP_041495;
Name=5;
IsoId=Q86WD7-5; Sequence=VSP_041488;
Name=6;
IsoId=Q86WD7-6; Sequence=VSP_041489;
Name=7;
IsoId=Q86WD7-7; Sequence=VSP_041491;
-!- TISSUE SPECIFICITY: Highly expressed in normal germinal center
(GC) B-cells and GC B-cell-derived malignancies.
{ECO:0000269|PubMed:12819018, ECO:0000269|PubMed:17447896,
ECO:0000269|PubMed:17898315, ECO:0000269|PubMed:18550480}.
-!- SIMILARITY: Belongs to the serpin family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAO32345.1; Type=Erroneous translation; Note=Wrong choice of CDS.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY220118; AAO65242.1; -; mRNA.
EMBL; AY220119; AAO65243.1; -; mRNA.
EMBL; AY220120; AAO65244.1; -; mRNA.
EMBL; AY220121; AAO65245.1; -; mRNA.
EMBL; AY185496; AAO32345.1; ALT_SEQ; mRNA.
EMBL; AY185497; AAO32346.1; -; mRNA.
EMBL; AY358700; AAQ89063.1; -; mRNA.
EMBL; AK301082; BAG62686.1; -; mRNA.
EMBL; AL132708; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC111498; AAI11499.1; -; mRNA.
CCDS; CCDS41982.1; -. [Q86WD7-7]
CCDS; CCDS41983.1; -. [Q86WD7-2]
CCDS; CCDS61542.1; -. [Q86WD7-5]
RefSeq; NP_001035983.1; NM_001042518.1. [Q86WD7-2]
RefSeq; NP_001271204.1; NM_001284275.1.
RefSeq; NP_001271205.1; NM_001284276.1. [Q86WD7-5]
RefSeq; NP_783866.2; NM_175739.3. [Q86WD7-7]
RefSeq; XP_011535016.1; XM_011536714.2. [Q86WD7-1]
RefSeq; XP_011535017.1; XM_011536715.2. [Q86WD7-1]
RefSeq; XP_011535018.1; XM_011536716.2. [Q86WD7-6]
RefSeq; XP_011535019.1; XM_011536717.1. [Q86WD7-6]
UniGene; Hs.317970; -.
ProteinModelPortal; Q86WD7; -.
SMR; Q86WD7; -.
BioGrid; 130609; 1.
STRING; 9606.ENSP00000337133; -.
MEROPS; I04.082; -.
iPTMnet; Q86WD7; -.
PhosphoSitePlus; Q86WD7; -.
BioMuta; SERPINA9; -.
DMDM; 215274213; -.
PaxDb; Q86WD7; -.
PeptideAtlas; Q86WD7; -.
PRIDE; Q86WD7; -.
Ensembl; ENST00000298845; ENSP00000298845; ENSG00000170054. [Q86WD7-2]
Ensembl; ENST00000337425; ENSP00000337133; ENSG00000170054. [Q86WD7-7]
Ensembl; ENST00000380365; ENSP00000369723; ENSG00000170054. [Q86WD7-1]
Ensembl; ENST00000424550; ENSP00000409012; ENSG00000170054. [Q86WD7-5]
Ensembl; ENST00000448305; ENSP00000414092; ENSG00000170054. [Q86WD7-6]
Ensembl; ENST00000538527; ENSP00000441511; ENSG00000170054. [Q86WD7-3]
Ensembl; ENST00000546329; ENSP00000445476; ENSG00000170054. [Q86WD7-4]
GeneID; 327657; -.
KEGG; hsa:327657; -.
UCSC; uc001yde.4; human. [Q86WD7-1]
CTD; 327657; -.
DisGeNET; 327657; -.
EuPathDB; HostDB:ENSG00000170054.14; -.
GeneCards; SERPINA9; -.
H-InvDB; HIX0037697; -.
HGNC; HGNC:15995; SERPINA9.
MIM; 615677; gene.
neXtProt; NX_Q86WD7; -.
OpenTargets; ENSG00000170054; -.
PharmGKB; PA38077; -.
eggNOG; KOG2392; Eukaryota.
eggNOG; COG4826; LUCA.
GeneTree; ENSGT00760000118839; -.
HOVERGEN; HBG005957; -.
InParanoid; Q86WD7; -.
KO; K04525; -.
OMA; FQHLVHS; -.
OrthoDB; EOG091G0ION; -.
PhylomeDB; Q86WD7; -.
TreeFam; TF343201; -.
ChiTaRS; SERPINA9; human.
GeneWiki; SERPINA9; -.
GenomeRNAi; 327657; -.
PRO; PR:Q86WD7; -.
Proteomes; UP000005640; Chromosome 14.
Bgee; ENSG00000170054; -.
CleanEx; HS_SERPINA11; -.
CleanEx; HS_SERPINA9; -.
Genevisible; Q86WD7; HS.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0016020; C:membrane; IEA:UniProtKB-SubCell.
GO; GO:0004867; F:serine-type endopeptidase inhibitor activity; IDA:UniProtKB.
InterPro; IPR023795; Serpin_CS.
InterPro; IPR023796; Serpin_dom.
InterPro; IPR000215; Serpin_fam.
InterPro; IPR036186; Serpin_sf.
PANTHER; PTHR11461; PTHR11461; 1.
Pfam; PF00079; Serpin; 1.
SMART; SM00093; SERPIN; 1.
SUPFAM; SSF56574; SSF56574; 1.
PROSITE; PS00284; SERPIN; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Glycoprotein;
Membrane; Polymorphism; Protease inhibitor; Reference proteome;
Secreted; Serine protease inhibitor; Signal.
SIGNAL 1 23 {ECO:0000255}.
CHAIN 24 417 Serpin A9.
/FTId=PRO_0000041971.
CARBOHYD 101 101 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 390 390 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 417 MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPA
SQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAML
SLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTV
PSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTD
FSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNH
IFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQF
AFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALS
ARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQ
NVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAA
TTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGK
VENPTKS -> MRSAGGRGEIKVRRELQPSKQVSGLTNHAR
TGQEKRNLQRHILFQNGILPLWSTLCCWPLCSNLLCVPGQC
PQCIPPPFLHKEHPCLTGVFPQHRLCLPPIPQAGFGDPESE
HLLLPCECLHFPGHALPWGPLSHQDPDSPGPGLQPHTHTRV
CHPPGLPAPGSLTDCSQQRPDLEDGKCPLRQEGAAAAGKFL
GQCQEAV (in isoform 3).
{ECO:0000303|Ref.2}.
/FTId=VSP_041492.
VAR_SEQ 1 131 Missing (in isoform 5).
{ECO:0000303|PubMed:12819018}.
/FTId=VSP_041488.
VAR_SEQ 1 80 Missing (in isoform 6).
{ECO:0000303|PubMed:12819018}.
/FTId=VSP_041489.
VAR_SEQ 1 57 MASYLYGVLFAVGLCAPIYCVSPANAPSAYPRPSSTKSTPA
SQVYSLNTDFAFRLYR -> MRSAGGRGEIKVRRELQPSKQ
VSGLTNHARTGQEKRNLQ (in isoform 4).
{ECO:0000303|Ref.2}.
/FTId=VSP_041490.
VAR_SEQ 1 1 M -> MQGQGRRRGTCKDIFCSKM (in isoform 2
and isoform 7).
{ECO:0000303|PubMed:12819018,
ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_041491.
VAR_SEQ 73 172 Missing (in isoform 2).
{ECO:0000303|PubMed:12819018}.
/FTId=VSP_041493.
VAR_SEQ 351 352 AT -> VS (in isoform 4).
{ECO:0000303|Ref.2}.
/FTId=VSP_041494.
VAR_SEQ 353 417 Missing (in isoform 4).
{ECO:0000303|Ref.2}.
/FTId=VSP_041495.
VARIANT 24 24 A -> V (in dbSNP:rs4905204).
/FTId=VAR_047344.
VARIANT 218 218 P -> L (in dbSNP:rs17090921).
{ECO:0000269|PubMed:12975309}.
/FTId=VAR_047345.
VARIANT 236 236 H -> Q (in dbSNP:rs28583900).
{ECO:0000269|PubMed:12975309}.
/FTId=VAR_047346.
VARIANT 292 292 R -> I (in dbSNP:rs28618118).
{ECO:0000269|PubMed:12975309}.
/FTId=VAR_047347.
VARIANT 330 330 V -> A (in dbSNP:rs11628722).
{ECO:0000269|PubMed:12819018,
ECO:0000269|PubMed:12975309}.
/FTId=VAR_047348.
CONFLICT 23 23 P -> L (in Ref. 1; AAO65242/AAO65243 and
3; AAQ89063). {ECO:0000305}.
CONFLICT 93 93 Q -> E (in Ref. 4; BAG62686).
{ECO:0000305}.
CONFLICT 174 174 R -> G (in Ref. 1; AAO65245).
{ECO:0000305}.
CONFLICT 207 207 F -> S (in Ref. 4; BAG62686).
{ECO:0000305}.
CONFLICT 224 224 N -> D (in Ref. 1; AAO65242).
{ECO:0000305}.
CONFLICT 228 228 L -> P (in Ref. 1; AAO65244).
{ECO:0000305}.
CONFLICT 371 371 T -> A (in Ref. 1; AAO65242).
{ECO:0000305}.
CONFLICT 411 411 V -> A (in Ref. 1; AAO65243 and 4;
BAG62686). {ECO:0000305}.
SEQUENCE 417 AA; 46557 MW; C7693D34FD2E12AB CRC64;
MASYLYGVLF AVGLCAPIYC VSPANAPSAY PRPSSTKSTP ASQVYSLNTD FAFRLYRRLV
LETPSQNIFF SPVSVSTSLA MLSLGAHSVT KTQILQGLGF NLTHTPESAI HQGFQHLVHS
LTVPSKDLTL KMGSALFVKK ELQLQANFLG NVKRLYEAEV FSTDFSNPSI AQARINSHVK
KKTQGKVVDI IQGLDLLTAM VLVNHIFFKA KWEKPFHPEY TRKNFPFLVG EQVTVHVPMM
HQKEQFAFGV DTELNCFVLQ MDYKGDAVAF FVLPSKGKMR QLEQALSART LRKWSHSLQK
RWIEVFIPRF SISASYNLET ILPKMGIQNV FDKNADFSGI AKRDSLQVSK ATHKAVLDVS
EEGTEATAAT TTKFIVRSKD GPSYFTVSFN RTFLMMITNK ATDGILFLGK VENPTKS


Related products :

Catalog number Product name Quantity
EIAAB39374 Centerin,GCET1,Germinal center B-cell-expressed transcript 1 protein,Homo sapiens,Human,Serpin A9,SERPINA11,SERPINA9,UNQ692_PRO1337
GCET2_MOUSE Mouse ELISA Kit FOR Germinal center B-cell-expressed transcript 2 protein 96T
CSB-EL009313HU Human Germinal center B-cell-expressed transcript 2 protein(GCET2) ELISA kit 96T
CSB-EL009313MO Mouse Germinal center B-cell-expressed transcript 2 protein(GCET2) ELISA kit 96T
CSB-EL009313HU Human Germinal center B-cell-expressed transcript 2 protein(GCET2) ELISA kit SpeciesHuman 96T
CSB-EL009313MO Mouse Germinal center B-cell-expressed transcript 2 protein(GCET2) ELISA kit SpeciesMouse 96T
GCET2_MOUSE ELISA Kit FOR Germinal center B-cell-expressed transcript 2 protein; organism: Mouse; gene name: Gcet2 96T
ARP55553_P050 GCET2(germinal center expressed transcript 2) 50 µg
ARP55553_P050 GCET2(germinal center expressed transcript 2) 50 µg
GCG GCET2 Gene germinal center expressed transcript 2
E13751h Human Germinal Center Expressed Transcript 2 ELISA 96T
CSB-EL009313HU Human germinal center expressed transcript 2 (GCET2) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL009313MO Mouse germinal center expressed transcript 2 (GCET2) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
32-129 The CD19 antigen (95kDa) is expressed from the earliest stage of B progenitor development, on all peripheral B cells including germinal centre B cells, and all B cell lines and B cell leukaemia tested 0.1 mg
OETPRO757 Germinal Center-Associated Nuclear Protein Human Recombinant 2
OETPRO757 Germinal Center-Associated Nuclear Protein Human Recombinant 5
orb81137 Human Germinal Center-Associated Nuclear Protein protein Proteins 2
AP7065b Germinal Center Kinase (GCK_MAP4K2) Antibody (Center)
AP7065b Germinal Center Kinase (GCK_MAP4K2) Antibody (Center) 0.1 mg
E12055m Rat ELISA Kit FOR Placenta-expressed transcript 1 protein 96T
E0799d Pig ELISA Kit FOR Placenta-expressed transcript 1 protein 96T
EIAAB45519 Androgen receptor trapped clone 27 protein,ART-27,Homo sapiens,HSPC024,Human,Protein UXT,Ubiquitously expressed transcript protein,UXT
PLET1_MOUSE Mouse ELISA Kit FOR Placenta-expressed transcript 1 protein 96T
EIAAB31513 Pig,Placenta-expressed transcript 1 protein,PLET1,Sus scrofa
PLET1_HUMAN Human ELISA Kit FOR Placenta-expressed transcript 1 protein 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur