Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Short transient receptor potential channel 2 (TrpC2) (Transient receptor protein 2) (TRP-2) (mTrp2)

 TRPC2_MOUSE             Reviewed;        1172 AA.
Q9R244; Q9ES59; Q9ES60; Q9R243;
20-JUN-2001, integrated into UniProtKB/Swiss-Prot.
23-MAR-2010, sequence version 2.
22-NOV-2017, entry version 152.
RecName: Full=Short transient receptor potential channel 2;
Short=TrpC2;
AltName: Full=Transient receptor protein 2;
Short=TRP-2;
Short=mTrp2;
Name=Trpc2; Synonyms=Trp2, Trrp2;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
TISSUE=Testis;
PubMed=10051594; DOI=10.1073/pnas.96.5.2060;
Vannier B., Peyton M., Boulay G., Brown D., Qin N., Jiang M., Zhu X.,
Birnbaumer L.;
"Mouse trp2, the homologue of the human trpc2 pseudogene, encodes
mTrp2, a store depletion-activated capacitative Ca2+ entry channel.";
Proc. Natl. Acad. Sci. U.S.A. 96:2060-2064(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4).
PubMed=10998353; DOI=10.1042/0264-6021:3510115;
Hofmann T., Schaefer M., Schultz G., Gudermann T.;
"Cloning, expression and subcellular localization of two novel splice
variants of mouse transient receptor potential channel 2.";
Biochem. J. 351:115-122(2000).
[3]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=11972034; DOI=10.1073/pnas.082127599;
Leypold B.G., Yu C.R., Leinders-Zufall T., Kim M.M., Zufall F.,
Axel R.;
"Altered sexual and social behaviors in trp2 mutant mice.";
Proc. Natl. Acad. Sci. U.S.A. 99:6376-6381(2002).
[4]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=11823606; DOI=10.1126/science.1069259;
Stowers L., Holy T.E., Meister M., Dulac C., Koentges G.;
"Loss of sex discrimination and male-male aggression in mice deficient
for TRP2.";
Science 295:1493-1500(2002).
[5]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=20596023; DOI=10.1038/nature09142;
Haga S., Hattori T., Sato T., Sato K., Matsuda S., Kobayakawa R.,
Sakano H., Yoshihara Y., Kikusui T., Touhara K.;
"The male mouse pheromone ESP1 enhances female sexual receptive
behaviour through a specific vomeronasal receptor.";
Nature 466:118-122(2010).
[6]
FUNCTION, AND DISRUPTION PHENOTYPE.
PubMed=24089208; DOI=10.1038/nature12579;
Ferrero D.M., Moeller L.M., Osakada T., Horio N., Li Q., Roy D.S.,
Cichy A., Spehr M., Touhara K., Liberles S.D.;
"A juvenile mouse pheromone inhibits sexual behaviour through the
vomeronasal system.";
Nature 502:368-371(2013).
-!- FUNCTION: Thought to form a receptor-activated non-selective
calcium permeant cation channel. Probably is operated by a
phosphatidylinositol second messenger system activated by receptor
tyrosine kinases or G-protein coupled receptors. May also be
activated by intracellular calcium store depletion. Plays a role
in mediating responsivity to pheromones that elicit aggressive and
mating behaviors. Required for response to the Esp1 pheromone
which enhances female sexual receptive behavior and to the Esp22
pheromone which inhibits adult male mating behavior.
{ECO:0000269|PubMed:11823606, ECO:0000269|PubMed:11972034,
ECO:0000269|PubMed:20596023, ECO:0000269|PubMed:24089208}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Multi-pass membrane
protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=A;
IsoId=Q9R244-1; Sequence=Displayed;
Name=2; Synonyms=B;
IsoId=Q9R244-2; Sequence=VSP_006562;
Name=3; Synonyms=Alpha;
IsoId=Q9R244-3; Sequence=VSP_006564;
Name=4; Synonyms=Beta;
IsoId=Q9R244-4; Sequence=VSP_006563, VSP_006565;
-!- TISSUE SPECIFICITY: Isoform 3 is ubiquitously expressed at low
levels. Isoform 4 is expressed exclusively in vomeronasal organ.
-!- DISRUPTION PHENOTYPE: Reduced electrophysiological response to
pheromone mixtures in the vomeronasal organ. Mutant males and
nursing females are docile and fail to initiate aggressive attacks
on intruder males. Males display normal mating behavior towards
females but display increased sexual behavior towards prepubescent
females even when presented simultaneously with adult estrus
females and also show increased sexual behavior towards juvenile
and adult males. Lack of response to Esp1.
{ECO:0000269|PubMed:11823606, ECO:0000269|PubMed:11972034,
ECO:0000269|PubMed:20596023, ECO:0000269|PubMed:24089208}.
-!- SIMILARITY: Belongs to the transient receptor (TC 1.A.4) family.
STrpC subfamily. TRPC2 sub-subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF111108; AAD17196.1; -; mRNA.
EMBL; AF111107; AAD17195.1; -; mRNA.
EMBL; AF230803; AAG29951.1; -; mRNA.
EMBL; AF230802; AAG29950.1; -; mRNA.
CCDS; CCDS52333.1; -. [Q9R244-4]
RefSeq; NP_001103367.1; NM_001109897.2. [Q9R244-4]
UniGene; Mm.292904; -.
ProteinModelPortal; Q9R244; -.
SMR; Q9R244; -.
CORUM; Q9R244; -.
DIP; DIP-61090N; -.
IntAct; Q9R244; 2.
STRING; 10090.ENSMUSP00000081903; -.
GuidetoPHARMACOLOGY; 487; -.
iPTMnet; Q9R244; -.
PhosphoSitePlus; Q9R244; -.
PaxDb; Q9R244; -.
PRIDE; Q9R244; -.
DNASU; 22064; -.
Ensembl; ENSMUST00000124189; ENSMUSP00000116934; ENSMUSG00000100254. [Q9R244-4]
GeneID; 22064; -.
KEGG; mmu:22064; -.
UCSC; uc009iqm.2; mouse. [Q9R244-3]
UCSC; uc009iqn.2; mouse. [Q9R244-2]
UCSC; uc012fqr.2; mouse. [Q9R244-1]
UCSC; uc012fqs.2; mouse. [Q9R244-4]
CTD; 7221; -.
MGI; MGI:109527; Trpc2.
eggNOG; KOG3609; Eukaryota.
eggNOG; ENOG410XQ0Y; LUCA.
GeneTree; ENSGT00760000119180; -.
HOGENOM; HOG000137678; -.
HOVERGEN; HBG101351; -.
InParanoid; Q9R244; -.
KO; K04965; -.
OrthoDB; EOG091G0KP0; -.
PhylomeDB; Q9R244; -.
PRO; PR:Q9R244; -.
Proteomes; UP000000589; Chromosome 7.
Bgee; ENSMUSG00000100254; -.
Genevisible; Q9R244; MM.
GO; GO:0032590; C:dendrite membrane; IMP:MGI.
GO; GO:0012505; C:endomembrane system; IDA:MGI.
GO; GO:0005789; C:endoplasmic reticulum membrane; IDA:MGI.
GO; GO:0000139; C:Golgi membrane; IDA:MGI.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005635; C:nuclear envelope; IDA:MGI.
GO; GO:0005886; C:plasma membrane; IDA:MGI.
GO; GO:0005516; F:calmodulin binding; IDA:MGI.
GO; GO:0003684; F:damaged DNA binding; IEA:InterPro.
GO; GO:0019992; F:diacylglycerol binding; IMP:MGI.
GO; GO:0070679; F:inositol 1,4,5 trisphosphate binding; IDA:BHF-UCL.
GO; GO:0015279; F:store-operated calcium channel activity; IDA:MGI.
GO; GO:0007340; P:acrosome reaction; IMP:MGI.
GO; GO:0006816; P:calcium ion transport; IMP:MGI.
GO; GO:0008050; P:female courtship behavior; IMP:MGI.
GO; GO:0002121; P:inter-male aggressive behavior; IMP:MGI.
GO; GO:0006828; P:manganese ion transport; IBA:GO_Central.
GO; GO:0048047; P:mating behavior, sex discrimination; IMP:MGI.
GO; GO:1902436; P:negative regulation of male mating behavior; IGI:MGI.
GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; IPI:MGI.
GO; GO:0010468; P:regulation of gene expression; IMP:MGI.
GO; GO:0019236; P:response to pheromone; IMP:MGI.
GO; GO:0000012; P:single strand break repair; IEA:InterPro.
GO; GO:0002124; P:territorial aggressive behavior; IMP:MGI.
CDD; cd00204; ANK; 1.
Gene3D; 1.25.40.20; -; 1.
Gene3D; 2.60.120.260; -; 1.
InterPro; IPR020683; Ankyrin_rpt-contain_dom.
InterPro; IPR036770; Ankyrin_rpt-contain_sf.
InterPro; IPR008979; Galactose-bd-like_sf.
InterPro; IPR005821; Ion_trans_dom.
InterPro; IPR013555; TRP_dom.
InterPro; IPR005458; TRPC2_channel.
InterPro; IPR002153; TRPC_channel.
InterPro; IPR002706; Xrcc1_N.
PANTHER; PTHR10117; PTHR10117; 1.
PANTHER; PTHR10117:SF6; PTHR10117:SF6; 1.
Pfam; PF00520; Ion_trans; 1.
Pfam; PF08344; TRP_2; 1.
Pfam; PF01834; XRCC1_N; 1.
PRINTS; PR01097; TRNSRECEPTRP.
PRINTS; PR01643; TRPCHANNEL2.
SUPFAM; SSF48403; SSF48403; 1.
SUPFAM; SSF49785; SSF49785; 1.
2: Evidence at transcript level;
Alternative splicing; ANK repeat; Calcium; Calcium channel;
Calcium transport; Complete proteome; Ion channel; Ion transport;
Membrane; Reference proteome; Repeat; Transmembrane;
Transmembrane helix; Transport.
CHAIN 1 1172 Short transient receptor potential
channel 2.
/FTId=PRO_0000215307.
TOPO_DOM 1 659 Cytoplasmic. {ECO:0000255}.
TRANSMEM 660 680 Helical. {ECO:0000255}.
TOPO_DOM 681 702 Extracellular. {ECO:0000255}.
TRANSMEM 703 723 Helical. {ECO:0000255}.
TOPO_DOM 724 738 Cytoplasmic. {ECO:0000255}.
TRANSMEM 739 759 Helical. {ECO:0000255}.
TOPO_DOM 760 789 Extracellular. {ECO:0000255}.
TRANSMEM 790 810 Helical. {ECO:0000255}.
TOPO_DOM 811 833 Cytoplasmic. {ECO:0000255}.
TRANSMEM 834 854 Helical. {ECO:0000255}.
TOPO_DOM 855 899 Extracellular. {ECO:0000255}.
TRANSMEM 900 920 Helical. {ECO:0000255}.
TOPO_DOM 921 1172 Cytoplasmic. {ECO:0000255}.
REPEAT 301 330 ANK 1.
REPEAT 377 406 ANK 2.
REPEAT 430 459 ANK 3.
COMPBIAS 1140 1143 Poly-Ser.
VAR_SEQ 1 111 MLMSRTDSKSGKNRSGVRMFKDGDFLTPASGESWDRLRLTC
SQPFTRHQSFGLAFLRVRSSLGSLADPVVDPSAPGSSGLNQ
NSTDVLESDPRPWLTNPSIRRTFFPDPQT -> MGTKTHPV
VPW (in isoform 2).
{ECO:0000303|PubMed:10051594}.
/FTId=VSP_006562.
VAR_SEQ 2 287 Missing (in isoform 3).
{ECO:0000303|PubMed:10998353}.
/FTId=VSP_006564.
VAR_SEQ 2 283 Missing (in isoform 4).
{ECO:0000303|PubMed:10998353}.
/FTId=VSP_006563.
VAR_SEQ 284 287 LVPK -> DPLS (in isoform 4).
{ECO:0000303|PubMed:10998353}.
/FTId=VSP_006565.
CONFLICT 628 628 K -> R (in Ref. 1; AAD17195/AAD17196).
{ECO:0000305}.
CONFLICT 633 633 F -> S (in Ref. 1; AAD17195/AAD17196).
{ECO:0000305}.
CONFLICT 653 653 Q -> R (in Ref. 2; AAG29951/AAG29950).
{ECO:0000305}.
CONFLICT 774 774 Y -> C (in Ref. 1; AAD17195/AAD17196).
{ECO:0000305}.
CONFLICT 797 797 A -> T (in Ref. 1; AAD17195/AAD17196).
{ECO:0000305}.
CONFLICT 1161 1161 L -> P (in Ref. 2; AAG29951/AAG29950).
{ECO:0000305}.
SEQUENCE 1172 AA; 130531 MW; D9A9A9FEE01D1536 CRC64;
MLMSRTDSKS GKNRSGVRMF KDGDFLTPAS GESWDRLRLT CSQPFTRHQS FGLAFLRVRS
SLGSLADPVV DPSAPGSSGL NQNSTDVLES DPRPWLTNPS IRRTFFPDPQ TSTKEISELK
GMLKQLQPGP LGRAARMVLS AARKAPPASV VSPNNSHGEP GPSRAESAEP RAEEPNRKTA
VGRRKRRKVQ EPRRSLSNSS SQPNRRTGRT RQRQHRPQTK SDDGGVQAAG QCPICAGFFS
IETLPQHAAT CGESPPPQPA SPASLSSSES VLRRHHVALT PVPLVPKPQP NWTEIVNKKL
KFPPTLLRAI QEGQLGLVQQ LLESSSDASG AGPGGPLRNV EESEDRSWRE ALNLAIRLGH
EVITDVLLAN VKFDFRQIHE ALLVAVDTNQ PAVVRRLLAR LEREKGRKVD TKSFSLAFFD
SSIDGSRFAP GVTPLTLACQ KDLYEIAQLL MDQGHTIARP HPVSCACLEC SNARRYDLLK
FSLSRINTYR GIASRAHLSL ASEDAMLAAF QLSRELRRLA RKEPEFKPQY IALESLCQDY
GFELLGMCRN QSEVTAVLND LGEDSETEPE AEGLGQAFEE GIPNLARLRL AVNYNQKQFV
AHPICQQVLS SIWCGNLAGW RGSTTIWKLF VAFLIFLTMP FLCIGYWLAP KSQLGRLLKI
PVLKFLLHSA SYLWFLIFLL GESLVMETQL STFKGRSQSV WETSLHMIWV TGFLWFECKE
VWIEGLRSYL LDWWNFLDVV ILSLYLASFA LRLLLAGLAY MHCRDASDST TCRYFTTAER
SEWRTEDPQF LAEVLFAVTS MLSFTRLAYI LPAHESLGTL QISIGKMIDD MIRFMFILMI
ILTAFLCGLN NIYVPYQESE KLGNFNETFQ FLFWTMFGME EHTVVDMPQF LVPEFVGRAM
YGIFTIVMVI VLLNMLIAMI TNSFQKIEDD ADVEWKFARS KLYLSYFREG LTLPVPFNIL
PSPKAAFYLV RRIFRFLCCG SSCCKAKKSD YPPIGTFTNP GARAGSAGEG ERVSYRLRVI
KALVQRYIET ARREFEETRR KDLGNRLTEL TKTVSRLQSE VASVQKNLAA GGAPRPPDGA
SILSRYITRV RNSFQNLGPP TSDTPAELTM PGIVETEVSL GDGLDGTGEA GAPAPGEPGS
SSSAHVLVHR EQEAEGSGDL LLEGDLETKG ES


Related products :

Catalog number Product name Quantity
EIAAB44070 Mouse,mTrp2,Mus musculus,Short transient receptor potential channel 2,Transient receptor protein 2,Trp2,TRP-2,TrpC2,Trpc2,Trrp2
EIAAB44071 Bos taurus,Bovine,bTrp2,Short transient receptor potential channel 2 homolog,Transient receptor protein 2,TRP2,TRP-2,TrpC2,TRPC2
EIAAB44072 Rat,Rattus norvegicus,rTrp2,Short transient receptor potential channel 2,Transient receptor protein 2,Trp2,TRP-2,TrpC2,Trpc2
CSB-EL025076RA Rat Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit 96T
H0653 Short transient receptor potential channel 2 homolog (TRPC2), Rat, ELISA Kit 96T
H0650 Short transient receptor potential channel 2 homolog (TRPC2), Bovine, ELISA Kit 96T
CSB-EL025076MO Mouse Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit 96T
CSB-EL025076RA Rat Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit SpeciesRat 96T
TRPC2_RAT ELISA Kit FOR Short transient receptor potential channel 2; organism: Rat; gene name: Trpc2 96T
CSB-EL025076HU Human Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit 96T
CSB-EL025076BO Bovine Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit 96T
H0651 Short transient receptor potential channel 2 homolog (TRPC2), Human, ELISA Kit 96T
H0652 Short transient receptor potential channel 2 homolog (TRPC2), Mouse, ELISA Kit 96T
TRPC2_MOUSE ELISA Kit FOR Short transient receptor potential channel 2; organism: Mouse; gene name: Trpc2 96T
CSB-EL025076BO Bovine Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit SpeciesBovine 96T
CSB-EL025076HU Human Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit SpeciesHuman 96T
CSB-EL025076MO Mouse Short transient receptor potential channel 2 homolog(TRPC2) ELISA kit SpeciesMouse 96T
EIAAB44103 Long transient receptor potential channel 7,LTrpC7,LTrpC-7,Rat,Rattus norvegicus,Transient receptor potential cation channel subfamily M member 7,Transient receptor potential-phospholipase C-interacti
EIAAB44104 Chak,Channel-kinase 1,Long transient receptor potential channel 7,LTrpC7,Ltrpc7,LTrpC-7,Mouse,Mus musculus,Transient receptor potential cation channel subfamily M member 7,Transient receptor potential
EIAAB44084 Calcium entry channel,Mouse,Mus musculus,Short transient receptor potential channel 6,Transient receptor protein 6,Trp6,TRP-6,TrpC6,Trpc6,Trrp6
EIAAB44106 Homo sapiens,Human,Long transient receptor potential channel 6,LTrpC6,LTRPC6,LTrpC-6,Transient receptor potential cation channel subfamily M member 8,Transient receptor potential p8,TRPM8,TRPP8,Trp-p8
18-001-30066 Transient receptor potential cation channel subfamily M member 8 - Transient receptor potential-p8; Trp-p8; Long transient receptor potential channel 6; LTrpC6 Polyclonal 0.1 mg
EIAAB44105 Long transient receptor potential channel 6,LTrpC6,Ltrpc6,LTrpC-6,Mouse,Mus musculus,Transient receptor potential cation channel subfamily M member 8,Transient receptor potential p8,Trpm8,Trpp8,Trp-p8
EIAAB44082 Capacitative calcium entry channel 2,CCE2,Mouse,mTRP5,Mus musculus,Short transient receptor potential channel 5,Transient receptor protein 5,Trp5,TRP-5,TrpC5,Trpc5,Trp-related protein 5,Trrp5
EIAAB44075 Mouse,mTrp3,Mus musculus,Receptor-activated cation channel TRP3,Short transient receptor potential channel 3,Transient receptor protein 3,Trp3,TRP-3,TrpC3,Trpc3,Trp-related protein 3,Trrp3


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur