Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Sodium-coupled neutral amino acid transporter 9 (Solute carrier family 38 member 9) (Up-regulated in lung cancer 11)

 S38A9_HUMAN             Reviewed;         561 AA.
Q8NBW4; A0A0A8K8P2; B3KXV1; B7Z7D0; Q0P5S0; Q6MZJ8;
08-APR-2008, integrated into UniProtKB/Swiss-Prot.
18-MAY-2010, sequence version 2.
25-OCT-2017, entry version 120.
RecName: Full=Sodium-coupled neutral amino acid transporter 9 {ECO:0000305};
AltName: Full=Solute carrier family 38 member 9 {ECO:0000312|HGNC:HGNC:26907};
AltName: Full=Up-regulated in lung cancer 11 {ECO:0000303|Ref.2};
Name=SLC38A9 {ECO:0000312|HGNC:HGNC:26907};
Synonyms=URLC11 {ECO:0000303|Ref.2};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), AND
VARIANT THR-182.
TISSUE=Placenta, and Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
THR-182.
Daigo Y., Nakamura Y.;
"Isolation and characterization of novel human genes, which are up-
regulated in lung cancer.";
Submitted (JAN-2015) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15372022; DOI=10.1038/nature02919;
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S.,
Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M.,
She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.,
Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M.,
Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T.,
Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M.,
Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K.,
Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C.,
Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M.,
Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A.,
Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M.,
Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M.,
Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S.,
Richardson P., Lucas S.M., Myers R.M., Rubin E.M.;
"The DNA sequence and comparative analysis of human chromosome 5.";
Nature 431:268-274(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
THR-182.
TISSUE=Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 173-561 (ISOFORM 2), AND
VARIANT THR-182.
TISSUE=Fetal kidney;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[7]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[8]
FUNCTION, SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY,
SUBUNIT, GLYCOSYLATION, AND MUTAGENESIS OF 38-ARG--PHE-40;
70-TYR--ARG-73; 85-PRO--HIS-87; 98-TYR--LEU-101 AND ASN-128.
PubMed=25561175; DOI=10.1038/nature14107;
Rebsamen M., Pochini L., Stasyk T., de Araujo M.E., Galluccio M.,
Kandasamy R.K., Snijder B., Fauster A., Rudashevskaya E.L.,
Bruckner M., Scorzoni S., Filipek P.A., Huber K.V., Bigenzahn J.W.,
Heinz L.X., Kraft C., Bennett K.L., Indiveri C., Huber L.A.,
Superti-Furga G.;
"SLC38A9 is a component of the lysosomal amino acid sensing machinery
that controls mTORC1.";
Nature 519:477-481(2015).
[9]
FUNCTION, SUBCELLULAR LOCATION, SUBUNIT, GLYCOSYLATION, AND
MUTAGENESIS OF HIS-60; ILE-68; TYR-71; LEU-74; PRO-85 AND PRO-90.
PubMed=25567906; DOI=10.1126/science.1257132;
Wang S., Tsun Z.Y., Wolfson R.L., Shen K., Wyant G.A., Plovanich M.E.,
Yuan E.D., Jones T.D., Chantranupong L., Comb W., Wang T.,
Bar-Peled L., Zoncu R., Straub C., Kim C., Park J., Sabatini B.L.,
Sabatini D.M.;
"Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine
sufficiency to mTORC1.";
Science 347:188-194(2015).
-!- FUNCTION: Lysosomal amino acid transporter involved in the
activation of mTORC1 in response to amino acids. Probably acts as
an amino acid sensor of the Rag GTPases and Ragulator complexes, 2
complexes involved in amino acid sensing and activation of mTORC1,
a signaling complex promoting cell growth in response to growth
factors, energy levels, and amino acids (PubMed:25561175,
PubMed:25567906). Following activation by amino acids, the
Ragulator and Rag GTPases function as a scaffold recruiting mTORC1
to lysosomes where it is in turn activated. SLC38A9 mediates
transport of amino acids with low capacity and specificity with a
slight preference for polar amino acids, suggesting that it acts
as an amino acid sensor instead (PubMed:25561175,
PubMed:25567906). The high concentration of arginine in lysosomes
suggests that it acts as an arginine sensor (PubMed:25567906).
{ECO:0000269|PubMed:25561175, ECO:0000269|PubMed:25567906}.
-!- SUBUNIT: Associated component of the Ragulator complex (composed
of LAMTOR1, LAMTOR2, LAMTOR3, LAMTOR4 and LAMTOR5). Associated
component of the Rag GTPases heterodimers (composed of RRAGA,
RRAGB, RRAGC and RRAGD). {ECO:0000269|PubMed:25561175,
ECO:0000269|PubMed:25567906}.
-!- INTERACTION:
Q6IAA8:LAMTOR1; NbExp=12; IntAct=EBI-9978316, EBI-715385;
Q9Y2Q5:LAMTOR2; NbExp=3; IntAct=EBI-9978316, EBI-2643704;
Q9UHA4:LAMTOR3; NbExp=5; IntAct=EBI-9978316, EBI-1038192;
Q0VGL1:LAMTOR4; NbExp=4; IntAct=EBI-9978316, EBI-5658976;
O43504:LAMTOR5; NbExp=4; IntAct=EBI-9978316, EBI-713382;
Q7L523:RRAGA; NbExp=12; IntAct=EBI-9978316, EBI-752376;
Q5VZM2:RRAGB; NbExp=2; IntAct=EBI-9978316, EBI-993049;
Q9HB90:RRAGC; NbExp=12; IntAct=EBI-9978316, EBI-752390;
-!- SUBCELLULAR LOCATION: Lysosome membrane
{ECO:0000269|PubMed:25561175, ECO:0000269|PubMed:25567906}; Multi-
pass membrane protein {ECO:0000255}. Late endosome membrane
{ECO:0000269|PubMed:25561175}; Multi-pass membrane protein
{ECO:0000255}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q8NBW4-1; Sequence=Displayed;
Name=2;
IsoId=Q8NBW4-2; Sequence=VSP_032815;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q8NBW4-3; Sequence=VSP_045111, VSP_045112;
Name=4;
IsoId=Q8NBW4-4; Sequence=VSP_045110;
-!- DOMAIN: The cytosolic N-terminus part of the protein mediates
interaction with the Ragulator complex and the Rag GTPases
heterodimers. {ECO:0000269|PubMed:25561175,
ECO:0000269|PubMed:25567906}.
-!- PTM: Glycosylated. {ECO:0000269|PubMed:25561175,
ECO:0000269|PubMed:25567906}.
-!- SIMILARITY: Belongs to the amino acid/polyamine transporter 2
family. SLC38A9 subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAQ19756.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AK075190; BAC11460.1; -; mRNA.
EMBL; AK127988; BAG54613.1; -; mRNA.
EMBL; AK301850; BAH13566.1; -; mRNA.
EMBL; AB105188; BAQ19756.1; ALT_INIT; mRNA.
EMBL; AC008784; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC016632; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471123; EAW54926.1; -; Genomic_DNA.
EMBL; BC066891; AAH66891.1; -; mRNA.
EMBL; BC101362; AAI01363.1; -; mRNA.
EMBL; BX641065; CAE46032.1; -; mRNA.
CCDS; CCDS3968.1; -. [Q8NBW4-1]
CCDS; CCDS58947.1; -. [Q8NBW4-4]
CCDS; CCDS58948.1; -. [Q8NBW4-3]
RefSeq; NP_001245215.1; NM_001258286.1. [Q8NBW4-4]
RefSeq; NP_001245216.1; NM_001258287.1. [Q8NBW4-3]
RefSeq; NP_775785.2; NM_173514.3. [Q8NBW4-1]
RefSeq; XP_006714600.1; XM_006714537.2.
RefSeq; XP_006714601.1; XM_006714538.3.
RefSeq; XP_006714602.1; XM_006714539.3. [Q8NBW4-1]
RefSeq; XP_011541475.1; XM_011543173.1.
RefSeq; XP_011541476.1; XM_011543174.1. [Q8NBW4-1]
UniGene; Hs.742101; -.
UniGene; Hs.745105; -.
ProteinModelPortal; Q8NBW4; -.
BioGrid; 127480; 14.
DIP; DIP-61480N; -.
IntAct; Q8NBW4; 17.
STRING; 9606.ENSP00000316596; -.
TCDB; 2.A.18.9.1; the amino acid/auxin permease (aaap) family.
iPTMnet; Q8NBW4; -.
PhosphoSitePlus; Q8NBW4; -.
BioMuta; SLC38A9; -.
DMDM; 296452888; -.
MaxQB; Q8NBW4; -.
PaxDb; Q8NBW4; -.
PeptideAtlas; Q8NBW4; -.
PRIDE; Q8NBW4; -.
Ensembl; ENST00000318672; ENSP00000316596; ENSG00000177058. [Q8NBW4-1]
Ensembl; ENST00000396865; ENSP00000380074; ENSG00000177058. [Q8NBW4-1]
Ensembl; ENST00000512595; ENSP00000427335; ENSG00000177058. [Q8NBW4-3]
Ensembl; ENST00000515629; ENSP00000420934; ENSG00000177058. [Q8NBW4-4]
GeneID; 153129; -.
KEGG; hsa:153129; -.
UCSC; uc003jqd.4; human. [Q8NBW4-1]
CTD; 153129; -.
DisGeNET; 153129; -.
EuPathDB; HostDB:ENSG00000177058.11; -.
GeneCards; SLC38A9; -.
HGNC; HGNC:26907; SLC38A9.
HPA; HPA043785; -.
MIM; 616203; gene.
neXtProt; NX_Q8NBW4; -.
OpenTargets; ENSG00000177058; -.
PharmGKB; PA162403774; -.
eggNOG; KOG1305; Eukaryota.
eggNOG; COG0814; LUCA.
GeneTree; ENSGT00390000005646; -.
HOGENOM; HOG000294102; -.
HOVERGEN; HBG106242; -.
InParanoid; Q8NBW4; -.
KO; K14995; -.
OMA; KDCIEQN; -.
OrthoDB; EOG091G04X6; -.
PhylomeDB; Q8NBW4; -.
TreeFam; TF312989; -.
Reactome; R-HSA-1632852; Macroautophagy.
Reactome; R-HSA-165159; mTOR signalling.
Reactome; R-HSA-166208; mTORC1-mediated signalling.
Reactome; R-HSA-380972; Energy dependent regulation of mTOR by LKB1-AMPK.
Reactome; R-HSA-5628897; TP53 Regulates Metabolic Genes.
Reactome; R-HSA-8943724; Regulation of PTEN gene transcription.
GenomeRNAi; 153129; -.
PRO; PR:Q8NBW4; -.
Proteomes; UP000005640; Chromosome 5.
Bgee; ENSG00000177058; -.
CleanEx; HS_SLC38A9; -.
ExpressionAtlas; Q8NBW4; baseline and differential.
Genevisible; Q8NBW4; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005770; C:late endosome; IDA:UniProtKB.
GO; GO:0031902; C:late endosome membrane; IEA:UniProtKB-SubCell.
GO; GO:0005765; C:lysosomal membrane; TAS:Reactome.
GO; GO:0005764; C:lysosome; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0015171; F:amino acid transmembrane transporter activity; IDA:UniProtKB.
GO; GO:0003333; P:amino acid transmembrane transport; IDA:UniProtKB.
GO; GO:0007050; P:cell cycle arrest; TAS:Reactome.
GO; GO:0071230; P:cellular response to amino acid stimulus; IDA:UniProtKB.
GO; GO:0032008; P:positive regulation of TOR signaling; IDA:UniProtKB.
GO; GO:0016241; P:regulation of macroautophagy; TAS:Reactome.
InterPro; IPR013057; AA_transpt_TM.
Pfam; PF01490; Aa_trans; 2.
1: Evidence at protein level;
Alternative splicing; Amino-acid transport; Complete proteome;
Endosome; Glycoprotein; Lysosome; Membrane; Polymorphism;
Reference proteome; Transmembrane; Transmembrane helix; Transport.
CHAIN 1 561 Sodium-coupled neutral amino acid
transporter 9.
/FTId=PRO_0000328840.
TOPO_DOM 1 119 Cytoplasmic.
{ECO:0000305|PubMed:25561175}.
TRANSMEM 120 140 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 141 144 Lumenal. {ECO:0000305}.
TRANSMEM 145 165 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 166 198 Cytoplasmic. {ECO:0000305}.
TRANSMEM 199 219 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 220 290 Lumenal. {ECO:0000305}.
TRANSMEM 291 311 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 312 313 Cytoplasmic. {ECO:0000305}.
TRANSMEM 314 334 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 335 358 Lumenal. {ECO:0000305}.
TRANSMEM 359 379 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 380 392 Cytoplasmic. {ECO:0000305}.
TRANSMEM 393 413 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 414 440 Lumenal. {ECO:0000305}.
TRANSMEM 441 461 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 462 477 Cytoplasmic. {ECO:0000305}.
TRANSMEM 478 498 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 499 509 Lumenal. {ECO:0000305}.
TRANSMEM 510 530 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 531 540 Cytoplasmic. {ECO:0000305}.
TRANSMEM 541 561 Helical; Name=11. {ECO:0000255}.
CARBOHYD 239 239 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 248 248 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 266 266 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
CARBOHYD 274 274 N-linked (GlcNAc...) asparagine.
{ECO:0000255|PROSITE-ProRule:PRU00498}.
VAR_SEQ 1 63 Missing (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_045110.
VAR_SEQ 1 37 MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK ->
MAICILTWRI (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_045111.
VAR_SEQ 318 353 Missing (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_045112.
VAR_SEQ 428 561 NFLDNFPSSDTLSFIARIFLLFQMMTVYPLLGYLARVQLLG
HIFGDIYPSIFHVLILNLIIVGAGVIMACFYPNIGGIIRYS
GAACGLAFVFIYPSLIYIISLHQEERLTWPKLIFHVFIIIL
GVANLIVQFFM -> VRHRVPSLCDCVHFHVFIVGRVIQWQ
DITSDRPGF (in isoform 2).
{ECO:0000303|PubMed:17974005}.
/FTId=VSP_032815.
VARIANT 182 182 S -> T (in dbSNP:rs4865615).
{ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:17974005}.
/FTId=VAR_042546.
MUTAGEN 38 40 RPF->AAA: Abolishes interaction with the
Ragulator and Rag GTPases complexes.
{ECO:0000269|PubMed:25561175}.
MUTAGEN 60 60 H->A: Does not affect association with
the Ragulator complex.
{ECO:0000269|PubMed:25567906}.
MUTAGEN 68 68 I->A: Abolishes association with the
Ragulator complex.
{ECO:0000269|PubMed:25567906}.
MUTAGEN 70 73 YYSR->AAAA: Abolishes interaction with
the Ragulator and Rag GTPases complexes.
{ECO:0000269|PubMed:25561175}.
MUTAGEN 71 71 Y->A: Abolishes association with the
Ragulator complex.
{ECO:0000269|PubMed:25567906}.
MUTAGEN 74 74 L->A: Abolishes association with the
Ragulator complex.
{ECO:0000269|PubMed:25567906}.
MUTAGEN 85 87 PDH->AAA: Abolishes interaction with the
Ragulator and Rag GTPases complexes.
{ECO:0000269|PubMed:25561175}.
MUTAGEN 85 85 P->A: Abolishes association with the
Ragulator complex.
{ECO:0000269|PubMed:25567906}.
MUTAGEN 90 90 P->A: Abolishes association with the
Ragulator complex.
{ECO:0000269|PubMed:25567906}.
MUTAGEN 98 101 YSPL->AAAA: Does not affect interaction
with the Ragulator and Rag GTPases
complexes. {ECO:0000269|PubMed:25561175}.
MUTAGEN 128 128 N->A: Moderately affects amino acid
transport. {ECO:0000269|PubMed:25561175}.
CONFLICT 84 84 A -> P (in Ref. 5; AAH66891).
{ECO:0000305}.
SEQUENCE 561 AA; 63776 MW; 0C1A3A136158168A CRC64;
MANMNSDSRH LGTSEVDHER DPGPMNIQFE PSDLRSKRPF CIEPTNIVNV NHVIQRVSDH
ASAMNKRIHY YSRLTTPADK ALIAPDHVVP APEECYVYSP LGSAYKLQSY TEGYGKNTSL
VTIFMIWNTM MGTSILSIPW GIKQAGFTTG MCVIILMGLL TLYCCYRVVK SRTMMFSLDT
TSWEYPDVCR HYFGSFGQWS SLLFSLVSLI GAMIVYWVLM SNFLFNTGKF IFNFIHHIND
TDTILSTNNS NPVICPSAGS GGHPDNSSMI FYANDTGAQQ FEKWWDKSRT VPFYLVGLLL
PLLNFKSPSF FSKFNILGTV SVLYLIFLVT FKAVRLGFHL EFHWFIPTEF FVPEIRFQFP
QLTGVLTLAF FIHNCIITLL KNNKKQENNV RDLCIAYMLV TLTYLYIGVL VFASFPSPPL
SKDCIEQNFL DNFPSSDTLS FIARIFLLFQ MMTVYPLLGY LARVQLLGHI FGDIYPSIFH
VLILNLIIVG AGVIMACFYP NIGGIIRYSG AACGLAFVFI YPSLIYIISL HQEERLTWPK
LIFHVFIIIL GVANLIVQFF M


Related products :

Catalog number Product name Quantity
EIAAB36978 Amino acid transporter A3,ATA3,Homo sapiens,Human,Na(+)-coupled neutral amino acid transporter 4,NAT3,SLC38A4,SNAT4,Sodium-coupled neutral amino acid transporter 4,Solute carrier family 38 member 4,Sy
EIAAB36979 Amino acid transporter A3,Ata3,Na(+)-coupled neutral amino acid transporter 4,Rat,Rattus norvegicus,Slc38a4,Snat4,Sodium-coupled neutral amino acid transporter 4,Solute carrier family 38 member 4,Syst
EIAAB36980 Amino acid transporter A3,Ata3,Mouse,Mus musculus,Na(+)-coupled neutral amino acid transporter 4,Nat3,Slc38a4,Snat4,Sodium-coupled neutral amino acid transporter 4,Solute carrier family 38 member 4,Sy
EIAAB36975 Na(+)-coupled neutral amino acid transporter 3,N-system amino acid transporter 1,Rat,Rattus norvegicus,Slc38a3,Snat3,Sodium-coupled neutral amino acid transporter 3,Solute carrier family 38 member 3,S
EIAAB36977 G17,Homo sapiens,Human,Na(+)-coupled neutral amino acid transporter 3,NAT1,N-system amino acid transporter 1,SLC38A3,SN1,SNAT3,Sodium-coupled neutral amino acid transporter 3,Solute carrier family 38
EIAAB36976 mNAT,Mouse,Mus musculus,Na(+)-coupled neutral amino acid transporter 3,N-system amino acid transporter 1,Slc38a3,Sn1,Snat3,Sodium-coupled neutral amino acid transporter 3,Solute carrier family 38 memb
EIAAB36968 Amino acid transporter A1,MNat2,Mouse,Mus musculus,Nat2,N-system amino acid transporter 2,Slc38a1,Snat1,Sodium-coupled neutral amino acid transporter 1,Solute carrier family 38 member 1,System A amino
EIAAB36973 Amino acid transporter A2,ATA2,Homo sapiens,Human,KIAA1382,Protein 40-9-1,SAT2,SLC38A2,SNAT2,Sodium-coupled neutral amino acid transporter 2,Solute carrier family 38 member 2,System A amino acid trans
EIAAB36970 Amino acid transporter A2,Ata2,Kiaa1382,Mouse,Mus musculus,Sat2,Slc38a2,Snat2,Sodium-coupled neutral amino acid transporter 2,Solute carrier family 38 member 2,System A amino acid transporter 2,System
EIAAB36974 Amino acid transporter A2,Ata2,Rat,Rattus norvegicus,Sa1,Sat2,Slc38a2,Snat2,Sodium-coupled neutral amino acid transporter 2,Solute carrier family 38 member 2,System A amino acid transporter 2,System A
EIAAB36969 Amino acid transporter A1,ATA1,Homo sapiens,Human,NAT2,N-system amino acid transporter 2,SAT1,SLC38A1,SNAT1,Sodium-coupled neutral amino acid transporter 1,Solute carrier family 38 member 1,System A a
EIAAB36972 Amino acid transporter A2,Bos taurus,Bovine,Protein 40-9-1,SLC38A2,SNAT2,Sodium-coupled neutral amino acid transporter 2,Solute carrier family 38 member 2,System A amino acid transporter 2,System A tr
EIAAB36982 Bos taurus,Bovine,SLC38A5,SNAT5,Sodium-coupled neutral amino acid transporter 5,Solute carrier family 38 member 5,System N transporter 2
EIAAB36984 Rat,Rattus norvegicus,Slc38a5,Sn2,Snat5,Sodium-coupled neutral amino acid transporter 5,Solute carrier family 38 member 5,System N transporter 2
EIAAB36983 Jm24,Mouse,Mus musculus,Slc38a5,Sn2,Snat5,Sodium-coupled neutral amino acid transporter 5,Solute carrier family 38 member 5,System N transporter 2
EIAAB36986 Homo sapiens,Human,Na(+)-coupled neutral amino acid transporter 6,NAT1,NAT-1,N-system amino acid transporter 1,Probable sodium-coupled neutral amino acid transporter 6,SLC38A6,SNAT6,Solute carrier fam
EIAAB36985 Na(+)-coupled neutral amino acid transporter 6,Nat1,NAT-1,N-system amino acid transporter 1,Probable sodium-coupled neutral amino acid transporter 6,Rat,Rattus norvegicus,Slc38a6,Snat6,Solute carrier
EIAAB36971 Amino acid transporter A2,Chicken,Gallus gallus,RCJMB04_2k20,SLC38A2,SNAT2,Sodium-coupled neutral amino acid transporter 2,Solute carrier family 38 member 2,System A amino acid transporter 2,System A
EIAAB36981 Homo sapiens,Human,JM24,PP7194,SLC38A5,SN2,SNAT5,Sodium-coupled neutral amino acid transporter 5,Solute carrier family 38 member 5,System N transporter 2
EIAAB37150 B0at1,Rat,Rattus norvegicus,Slc6a19,Sodium-dependent neutral amino acid transporter B(0)AT1,Solute carrier family 6 member 19,System B(0) neutral amino acid transporter AT1
EIAAB37151 B0at1,Mouse,Mus musculus,Slc6a19,Sodium-dependent neutral amino acid transporter B(0)AT1,Solute carrier family 6 member 19,System B(0) neutral amino acid transporter AT1
EIAAB37149 B0AT1,Homo sapiens,Human,SLC6A19,Sodium-dependent neutral amino acid transporter B(0)AT1,Solute carrier family 6 member 19,System B(0) neutral amino acid transporter AT1
EIAAB37146 Homo sapiens,Human,SLC6A18,Sodium- and chloride-dependent transporter XTRP2,Sodium-dependent neutral amino acid transporter B(0)AT3,Solute carrier family 6 member 18,System B(0) neutral amino acid tra
EIAAB37148 Mouse,Mus musculus,Slc6a18,Sodium- and chloride-dependent transporter XTRP2,Sodium-dependent neutral amino acid transporter B(0)AT3,Solute carrier family 6 member 18,System B(0) neutral amino acid tra
18-003-43732 Neutral amino acid transporter B(0) - ATB(0); Solute carrier family 1 member 5; Sodium-dependent neutral amino acid transporter type 2; RD114_simian type D retrovirus receptor; Baboon M7 virus recepto 0.1 mg Protein A


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur