Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Solute carrier family 2, facilitated glucose transporter member 11 (Glucose transporter type 10) (GLUT-10) (Glucose transporter type 11) (GLUT-11)

 GTR11_HUMAN             Reviewed;         496 AA.
Q9BYW1; E9PH55; Q542Y4; Q6ICJ5; Q8WXF9; Q8WYM4;
16-NOV-2001, integrated into UniProtKB/Swiss-Prot.
01-JUN-2001, sequence version 1.
25-APR-2018, entry version 146.
RecName: Full=Solute carrier family 2, facilitated glucose transporter member 11;
AltName: Full=Glucose transporter type 10;
Short=GLUT-10;
AltName: Full=Glucose transporter type 11;
Short=GLUT-11;
Name=SLC2A11; Synonyms=GLUT10, GLUT11;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Heart;
Doege H., Bocianski A., Scheepers A., Axer H., Eckel J., Joost H.-G.;
"Two novel members of the family of sugar transport facilitators:
genomic organization and predominant expression in lymphocytes (GLUT9)
and muscle (GLUT10).";
Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 2 AND 4), AND VARIANT
GLN-232.
PubMed=11741323; DOI=10.1006/bbrc.2001.6101;
Sasaki T., Minoshima S., Shiohama A., Shintani A., Shimizu A.,
Asakawa S., Kawasaki K., Shimizu N.;
"Molecular cloning of a member of the facilitative glucose transporter
gene family GLUT11 (SLC2A11) and identification of transcription
variants.";
Biochem. Biophys. Res. Commun. 289:1218-1224(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), ALTERNATIVE SPLICING,
FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=12175779; DOI=10.1016/S1096-7192(02)00018-5;
Wu X., Li W., Sharma V., Godzik A., Freeze H.H.;
"Cloning and characterization of glucose transporter 11, a novel sugar
transporter that is alternatively spliced in various tissues.";
Mol. Genet. Metab. 76:37-45(2002).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
PubMed=15461802; DOI=10.1186/gb-2004-5-10-r84;
Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A.,
Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J.,
Beare D.M., Dunham I.;
"A genome annotation-driven approach to cloning the human ORFeome.";
Genome Biol. 5:R84.1-R84.11(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), AND VARIANT
GLN-232.
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Placenta;
PubMed=16303743; DOI=10.1093/dnares/12.2.117;
Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J.,
Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S.,
Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.,
Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S.,
Isogai T.;
"Signal sequence and keyword trap in silico for selection of full-
length human cDNAs encoding secretion or membrane proteins from oligo-
capped cDNA libraries.";
DNA Res. 12:117-126(2005).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=10591208; DOI=10.1038/990031;
Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M.,
Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K.,
Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P.,
Bird C.P., Blakey S.E., Bridgeman A.M., Buck D., Burgess J.,
Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G.,
Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R.,
Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E.,
Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G.,
Evans K.L., Fey J.M., Fleming K., French L., Garner A.A.,
Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C.,
Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S.,
Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A.,
Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M.,
Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T.,
Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J.,
Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T.,
Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T.,
Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L.,
Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M.,
Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L.,
Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L.,
Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N.,
Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J.,
Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S.,
Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T.,
Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I.,
Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H.,
Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L.,
Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z.,
Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P.,
Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S.,
Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J.,
Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T.,
Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J.,
Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R.,
Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S.,
Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E.,
Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P.,
Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E.,
O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X.,
Khan A.S., Lane L., Tilahun Y., Wright H.;
"The DNA sequence of human chromosome 22.";
Nature 402:489-495(1999).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Facilitative glucose transporter.
{ECO:0000269|PubMed:12175779}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:12175779};
Multi-pass membrane protein {ECO:0000269|PubMed:12175779}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=GLUT11;
IsoId=Q9BYW1-1; Sequence=Displayed;
Name=2; Synonyms=GLUT11-s;
IsoId=Q9BYW1-2; Sequence=VSP_006293, VSP_006294, VSP_006295;
Name=3;
IsoId=Q9BYW1-3; Sequence=VSP_006293;
Name=4; Synonyms=GLUT11-L;
IsoId=Q9BYW1-4; Sequence=VSP_045650;
-!- TISSUE SPECIFICITY: Expressed in heart and skeletal muscle.
-!- SIMILARITY: Belongs to the major facilitator superfamily. Sugar
transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
{ECO:0000305}.
-!- CAUTION: Has been described as GLUT10 in literature, but this gene
name has already been used for SLC2A10. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AJ271290; CAC29020.1; -; mRNA.
EMBL; AB049214; BAB68410.1; -; Genomic_DNA.
EMBL; AB067443; BAB83505.1; -; Genomic_DNA.
EMBL; AF443201; AAL39061.1; -; mRNA.
EMBL; CR456373; CAG30259.1; -; mRNA.
EMBL; AK075467; BAC11637.1; -; mRNA.
EMBL; AK314502; BAG37102.1; -; mRNA.
EMBL; AP000350; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471095; EAW59618.1; -; Genomic_DNA.
EMBL; BC100808; AAI00809.1; -; mRNA.
CCDS; CCDS13818.1; -. [Q9BYW1-4]
CCDS; CCDS33616.1; -. [Q9BYW1-3]
CCDS; CCDS46673.1; -. [Q9BYW1-1]
RefSeq; NP_001020109.1; NM_001024938.3. [Q9BYW1-1]
RefSeq; NP_001020110.1; NM_001024939.3. [Q9BYW1-3]
RefSeq; NP_110434.3; NM_030807.4. [Q9BYW1-4]
UniGene; Hs.661910; -.
UniGene; Hs.743282; -.
ProteinModelPortal; Q9BYW1; -.
STRING; 9606.ENSP00000381399; -.
DrugBank; DB09502; Fludeoxyglucose F-18.
TCDB; 2.A.1.1.44; the major facilitator superfamily (mfs).
iPTMnet; Q9BYW1; -.
PhosphoSitePlus; Q9BYW1; -.
BioMuta; SLC2A11; -.
DMDM; 17366685; -.
PaxDb; Q9BYW1; -.
PeptideAtlas; Q9BYW1; -.
PRIDE; Q9BYW1; -.
DNASU; 66035; -.
Ensembl; ENST00000316185; ENSP00000326748; ENSG00000133460. [Q9BYW1-3]
Ensembl; ENST00000345044; ENSP00000342542; ENSG00000133460. [Q9BYW1-1]
Ensembl; ENST00000398356; ENSP00000381399; ENSG00000133460. [Q9BYW1-4]
Ensembl; ENST00000618502; ENSP00000482495; ENSG00000275744. [Q9BYW1-1]
Ensembl; ENST00000619254; ENSP00000480839; ENSG00000275744. [Q9BYW1-4]
Ensembl; ENST00000620942; ENSP00000483163; ENSG00000275744. [Q9BYW1-3]
GeneID; 66035; -.
KEGG; hsa:66035; -.
UCSC; uc002zym.6; human. [Q9BYW1-1]
CTD; 66035; -.
DisGeNET; 66035; -.
EuPathDB; HostDB:ENSG00000133460.19; -.
GeneCards; SLC2A11; -.
HGNC; HGNC:14239; SLC2A11.
HPA; HPA042960; -.
HPA; HPA071184; -.
MIM; 610367; gene.
neXtProt; NX_Q9BYW1; -.
OpenTargets; ENSG00000133460; -.
PharmGKB; PA37861; -.
eggNOG; KOG0569; Eukaryota.
eggNOG; COG0477; LUCA.
GeneTree; ENSGT00760000119022; -.
HOGENOM; HOG000202871; -.
HOVERGEN; HBG014816; -.
InParanoid; Q9BYW1; -.
KO; K08148; -.
PhylomeDB; Q9BYW1; -.
TreeFam; TF313762; -.
Reactome; R-HSA-189200; Cellular hexose transport.
ChiTaRS; SLC2A11; human.
GeneWiki; SLC2A11; -.
GenomeRNAi; 66035; -.
PRO; PR:Q9BYW1; -.
Proteomes; UP000005640; Chromosome 22.
Bgee; ENSG00000133460; -.
CleanEx; HS_SLC2A11; -.
ExpressionAtlas; Q9BYW1; baseline and differential.
Genevisible; Q9BYW1; HS.
GO; GO:0030054; C:cell junction; IDA:HPA.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005634; C:nucleus; IDA:HPA.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0051119; F:sugar transmembrane transporter activity; TAS:Reactome.
GO; GO:0008645; P:hexose transmembrane transport; TAS:Reactome.
CDD; cd06174; MFS; 1.
InterPro; IPR020846; MFS_dom.
InterPro; IPR005828; MFS_sugar_transport-like.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR003663; Sugar/inositol_transpt.
InterPro; IPR005829; Sugar_transporter_CS.
Pfam; PF00083; Sugar_tr; 1.
PRINTS; PR00171; SUGRTRNSPORT.
SUPFAM; SSF103473; SSF103473; 1.
TIGRFAMs; TIGR00879; SP; 1.
PROSITE; PS50850; MFS; 1.
PROSITE; PS00217; SUGAR_TRANSPORT_2; 1.
2: Evidence at transcript level;
Alternative splicing; Cell membrane; Complete proteome; Glycoprotein;
Membrane; Polymorphism; Reference proteome; Sugar transport;
Transmembrane; Transmembrane helix; Transport.
CHAIN 1 496 Solute carrier family 2, facilitated
glucose transporter member 11.
/FTId=PRO_0000050380.
TOPO_DOM 1 11 Cytoplasmic. {ECO:0000255}.
TRANSMEM 12 32 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 33 61 Extracellular. {ECO:0000255}.
TRANSMEM 62 82 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 83 97 Cytoplasmic. {ECO:0000255}.
TRANSMEM 98 118 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 119 128 Extracellular. {ECO:0000255}.
TRANSMEM 129 149 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 150 157 Cytoplasmic. {ECO:0000255}.
TRANSMEM 158 178 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 179 187 Extracellular. {ECO:0000255}.
TRANSMEM 188 208 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 209 273 Cytoplasmic. {ECO:0000255}.
TRANSMEM 274 294 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 295 311 Extracellular. {ECO:0000255}.
TRANSMEM 312 332 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 333 338 Cytoplasmic. {ECO:0000255}.
TRANSMEM 339 359 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 360 364 Extracellular. {ECO:0000255}.
TRANSMEM 365 385 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 386 408 Cytoplasmic. {ECO:0000255}.
TRANSMEM 409 429 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 430 435 Extracellular. {ECO:0000255}.
TRANSMEM 436 456 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 457 496 Cytoplasmic. {ECO:0000255}.
CARBOHYD 47 47 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 7 MRALRRL -> MLHALLRSRM (in isoform 2 and
isoform 3).
{ECO:0000303|PubMed:15461802}.
/FTId=VSP_006293.
VAR_SEQ 1 7 MRALRRL -> MEDELEPSLRPRTQ (in isoform 4).
{ECO:0000303|PubMed:12175779,
ECO:0000303|PubMed:14702039}.
/FTId=VSP_045650.
VAR_SEQ 179 245 RELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLID
CGDTEACLAALRRLRGSGDLAGELEE -> STTAATGLRGL
GRGAGGAGGGARCLPGLPCPAPMGAVPASGPEETGDKPRGS
GQCHGALRE (in isoform 2). {ECO:0000305}.
/FTId=VSP_006294.
VAR_SEQ 246 496 Missing (in isoform 2). {ECO:0000305}.
/FTId=VSP_006295.
VARIANT 60 60 D -> N (in dbSNP:rs7292659).
/FTId=VAR_046704.
VARIANT 232 232 R -> Q (in dbSNP:rs9608213).
{ECO:0000269|PubMed:11741323,
ECO:0000269|PubMed:14702039}.
/FTId=VAR_046705.
VARIANT 301 301 R -> Q (in dbSNP:rs36015336).
/FTId=VAR_061881.
VARIANT 420 420 I -> F (in dbSNP:rs34096096).
/FTId=VAR_046706.
VARIANT 469 469 K -> E (in dbSNP:rs60882514).
/FTId=VAR_061882.
CONFLICT 229 229 A -> E (in Ref. 3; AAL39061).
{ECO:0000305}.
SEQUENCE 496 AA; 53703 MW; 55FFEA82C7007D6D CRC64;
MRALRRLIQG RILLLTICAA GIGGTFQFGY NLSIINAPTL HIQEFTNETW QARTGEPLPD
HLVLLMWSLI VSLYPLGGLF GALLAGPLAI TLGRKKSLLV NNIFVVSAAI LFGFSRKAGS
FEMIMLGRLL VGVNAGVSMN IQPMYLGESA PKELRGAVAM SSAIFTALGI VMGQVVGLRE
LLGGPQAWPL LLASCLVPGA LQLASLPLLP ESPRYLLIDC GDTEACLAAL RRLRGSGDLA
GELEELEEER AACQGCRARR PWELFQHRAL RRQVTSLVVL GSAMELCGND SVYAYASSVF
RKAGVPEAKI QYAIIGTGSC ELLTAVVSCV VIERVGRRVL LIGGYSLMTC WGSIFTVALC
LQSSFPWTLY LAMACIFAFI LSFGIGPAGV TGILATELFD QMARPAACMV CGALMWIMLI
LVGLGFPFIM EALSHFLYVP FLGVCVCGAI YTGLFLPETK GKTFQEISKE LHRLNFPRRA
QGPTWRSLEV IQSTEL


Related products :

Catalog number Product name Quantity
E1185h ELISA Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185h CLIA Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185h ELISA kit Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185m ELISA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,GT1,Mouse,Mus musculus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1635m CLIA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Mouse,Mus musculus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1635m ELISA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Mouse,Mus musculus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
U1635r CLIA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Rat,Rattus norvegicus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1635m ELISA kit Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Mouse,Mus musculus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1185r ELISA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,Rat,Rattus norvegicus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185m ELISA kit Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,GT1,Mouse,Mus musculus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185b CLIA Bos taurus,Bovine,Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,GLUT-I,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185m CLIA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,GT1,Mouse,Mus musculus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185r CLIA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,Rat,Rattus norvegicus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1635r ELISA kit Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Rat,Rattus norvegicus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1185b ELISA Bos taurus,Bovine,Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,GLUT-I,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1635r ELISA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Rat,Rattus norvegicus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1185r ELISA kit Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,Rat,Rattus norvegicus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185b ELISA kit Bos taurus,Bovine,Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,GLUT-I,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U2023m CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023r CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023m CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur