Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Solute carrier family 2, facilitated glucose transporter member 4 (Glucose transporter type 4, insulin-responsive) (GLUT-4)

 GTR4_HUMAN              Reviewed;         509 AA.
P14672; Q05BQ3; Q14CX2;
01-APR-1990, integrated into UniProtKB/Swiss-Prot.
01-APR-1990, sequence version 1.
23-MAY-2018, entry version 207.
RecName: Full=Solute carrier family 2, facilitated glucose transporter member 4;
AltName: Full=Glucose transporter type 4, insulin-responsive;
Short=GLUT-4;
Name=SLC2A4; Synonyms=GLUT4;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=2656669;
Fukumoto H., Kayano T., Buse J.B., Edwards Y., Pilch P.F., Bell G.I.,
Seino S.;
"Cloning and characterization of the major insulin-responsive glucose
transporter expressed in human skeletal muscle and other insulin-
responsive tissues.";
J. Biol. Chem. 264:7776-7779(1989).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT THR-385.
PubMed=1397719; DOI=10.2337/diab.41.11.1436;
Buse J.B., Yasuda K., Lay T.P., Seo T.S., Olson A.L., Pessin J.E.,
Karam J.H., Seino S., Bell G.I.;
"Human GLUT4/muscle-fat glucose-transporter gene. Characterization and
genetic variation.";
Diabetes 41:1436-1445(1992).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16625196; DOI=10.1038/nature04689;
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R.,
Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A.,
Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J.,
Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J.,
DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R.,
Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N.,
Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B.,
Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J.,
Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E.,
Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J.,
Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C.,
Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D.,
Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A.,
Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.;
"DNA sequence of human chromosome 17 and analysis of rearrangement in
the human lineage.";
Nature 440:1045-1049(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Colon;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-11.
PubMed=7916714; DOI=10.1016/0378-1119(93)90438-9;
Chiaramonte R., Martini R., Taramelli R., Comi P.;
"Identification of the 5' end of the gene encoding a human insulin-
responsive glucose transporter.";
Gene 130:307-308(1993).
[6]
SUBCELLULAR LOCATION, AND MUTAGENESIS OF 489-LEU-LEU-490.
PubMed=8300557;
Verhey K.J., Birnbaum M.J.;
"A Leu-Leu sequence is essential for COOH-terminal targeting signal of
GLUT4 glucose transporter in fibroblasts.";
J. Biol. Chem. 269:2353-2356(1994).
[7]
INTERACTION WITH DAXX, AND SUMOYLATION.
PubMed=11842083; DOI=10.1074/jbc.M110294200;
Lalioti V.S., Vergarajauregui S., Pulido D., Sandoval I.V.;
"The insulin-sensitive glucose transporter, GLUT4, interacts
physically with Daxx. Two proteins with capacity to bind Ubc9 and
conjugated to SUMO1.";
J. Biol. Chem. 277:19783-19791(2002).
[8]
INTERACTION WITH SRFBP1.
PubMed=16647043; DOI=10.1016/j.bbrc.2006.04.017;
Lisinski I., Matsumoto H., Yver D.R., Schuermann A., Cushman S.W.,
Al-Hasani H.;
"Identification and characterization of p49/STRAP as a novel GLUT4-
binding protein.";
Biochem. Biophys. Res. Commun. 344:1179-1185(2006).
[9]
PHOSPHORYLATION AT SER-274 BY SGK1.
PubMed=17382906; DOI=10.1016/j.bbrc.2007.03.029;
Jeyaraj S., Boehmer C., Lang F., Palmada M.;
"Role of SGK1 kinase in regulating glucose transport via glucose
transporter GLUT4.";
Biochem. Biophys. Res. Commun. 356:629-635(2007).
[10]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[11]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-57.
TISSUE=Leukemic T-cell;
PubMed=19349973; DOI=10.1038/nbt.1532;
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,
Schiess R., Aebersold R., Watts J.D.;
"Mass-spectrometric identification and relative quantification of N-
linked cell surface glycoproteins.";
Nat. Biotechnol. 27:378-386(2009).
[12]
VARIANT NIDDM ILE-383.
PubMed=1918382; DOI=10.1172/JCI115437;
Kusari J., Verma U.S., Buse J.B., Henry R.R., Olefsky J.M.;
"Analysis of the gene sequences of the insulin receptor and the
insulin-sensitive glucose transporter (GLUT-4) in patients with
common-type non-insulin-dependent diabetes mellitus.";
J. Clin. Invest. 88:1323-1330(1991).
[13]
VARIANT NIDDM ILE-383.
PubMed=1756912; DOI=10.2337/diab.40.12.1712;
Choi W.H., O'Rahilly S., Buse J.B., Rees A., Morgan R., Flier J.S.,
Moller D.E.;
"Molecular scanning of insulin-responsive glucose transporter (GLUT4)
gene in NIDDM subjects.";
Diabetes 40:1712-1718(1991).
[14]
VARIANT NIDDM ILE-383.
PubMed=1521731; DOI=10.1007/BF02342449;
O'Rahilly S., Krook A., Morgan R., Rees A., Flier J.S., Moller D.E.;
"Insulin receptor and insulin-responsive glucose transporter (GLUT 4)
mutations and polymorphisms in a Welsh type 2 (non-insulin-dependent)
diabetic population.";
Diabetologia 35:486-489(1992).
-!- FUNCTION: Insulin-regulated facilitative glucose transporter.
-!- SUBUNIT: Interacts with NDUFA9 (By similarity). Binds to DAXX.
Interacts via its N-terminus with SRFBP1. {ECO:0000250,
ECO:0000269|PubMed:11842083, ECO:0000269|PubMed:16647043}.
-!- INTERACTION:
O43889-2:CREB3; NbExp=3; IntAct=EBI-367146, EBI-625022;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Multi-pass
membrane protein {ECO:0000250}. Endomembrane system
{ECO:0000269|PubMed:8300557}; Multi-pass membrane protein
{ECO:0000269|PubMed:8300557}. Cytoplasm, perinuclear region
{ECO:0000269|PubMed:8300557}. Note=Localizes primarily to the
perinuclear region, undergoing continued recycling to the plasma
membrane where it is rapidly reinternalized. The dileucine
internalization motif is critical for intracellular sequestration.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P14672-1; Sequence=Displayed;
Name=2;
IsoId=P14672-2; Sequence=VSP_056331, VSP_056332;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Skeletal and cardiac muscles; brown and white
fat.
-!- PTM: Sumoylated. {ECO:0000269|PubMed:11842083}.
-!- DISEASE: Diabetes mellitus, non-insulin-dependent (NIDDM)
[MIM:125853]: A multifactorial disorder of glucose homeostasis
caused by a lack of sensitivity to the body's own insulin.
Affected individuals usually have an obese body habitus and
manifestations of a metabolic syndrome characterized by diabetes,
insulin resistance, hypertension and hypertriglyceridemia. The
disease results in long-term complications that affect the eyes,
kidneys, nerves, and blood vessels. {ECO:0000269|PubMed:1521731,
ECO:0000269|PubMed:1756912, ECO:0000269|PubMed:1918382}. Note=The
disease may be caused by mutations affecting the gene represented
in this entry.
-!- MISCELLANEOUS: Insulin-stimulated phosphorylation of TBC1D4 is
required for GLUT4 translocation. {ECO:0000250}.
-!- SIMILARITY: Belongs to the major facilitator superfamily. Sugar
transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
{ECO:0000305}.
-!- WEB RESOURCE: Name=Wikipedia; Note=GLUT4 entry;
URL="https://en.wikipedia.org/wiki/Glut4";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M20747; AAA59189.1; -; mRNA.
EMBL; M91463; AAA52569.1; -; Genomic_DNA.
EMBL; AC003688; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC034387; AAH34387.1; -; mRNA.
EMBL; BC069615; AAH69615.1; -; mRNA.
EMBL; BC069621; AAH69621.1; -; mRNA.
EMBL; BC113592; AAI13593.1; -; mRNA.
EMBL; BC126164; AAI26165.1; -; mRNA.
EMBL; X58489; CAA41399.1; -; Genomic_DNA.
CCDS; CCDS11097.1; -. [P14672-1]
PIR; A49158; A33801.
RefSeq; NP_001033.1; NM_001042.2. [P14672-1]
UniGene; Hs.380691; -.
ProteinModelPortal; P14672; -.
BioGrid; 112408; 39.
CORUM; P14672; -.
IntAct; P14672; 3.
MINT; P14672; -.
STRING; 9606.ENSP00000320935; -.
ChEMBL; CHEMBL5874; -.
DrugBank; DB09502; Fludeoxyglucose F-18.
TCDB; 2.A.1.1.80; the major facilitator superfamily (mfs).
iPTMnet; P14672; -.
PhosphoSitePlus; P14672; -.
SwissPalm; P14672; -.
BioMuta; SLC2A4; -.
DMDM; 121761; -.
EPD; P14672; -.
PaxDb; P14672; -.
PeptideAtlas; P14672; -.
PRIDE; P14672; -.
DNASU; 6517; -.
Ensembl; ENST00000317370; ENSP00000320935; ENSG00000181856. [P14672-1]
Ensembl; ENST00000572485; ENSP00000461086; ENSG00000181856. [P14672-2]
GeneID; 6517; -.
KEGG; hsa:6517; -.
UCSC; uc002gfp.4; human. [P14672-1]
CTD; 6517; -.
DisGeNET; 6517; -.
EuPathDB; HostDB:ENSG00000181856.14; -.
GeneCards; SLC2A4; -.
HGNC; HGNC:11009; SLC2A4.
HPA; CAB016544; -.
MalaCards; SLC2A4; -.
MIM; 125853; phenotype.
MIM; 138190; gene.
neXtProt; NX_P14672; -.
OpenTargets; ENSG00000181856; -.
PharmGKB; PA35879; -.
eggNOG; KOG0569; Eukaryota.
eggNOG; COG0477; LUCA.
GeneTree; ENSGT00760000119022; -.
HOGENOM; HOG000202871; -.
HOVERGEN; HBG014816; -.
InParanoid; P14672; -.
KO; K07191; -.
OMA; NVYVVFF; -.
OrthoDB; EOG091G0A9K; -.
PhylomeDB; P14672; -.
TreeFam; TF313762; -.
Reactome; R-HSA-1445148; Translocation of GLUT4 to the plasma membrane.
Reactome; R-HSA-189200; Cellular hexose transport.
Reactome; R-HSA-381340; Transcriptional regulation of white adipocyte differentiation.
SIGNOR; P14672; -.
GeneWiki; GLUT4; -.
GenomeRNAi; 6517; -.
PRO; PR:P14672; -.
Proteomes; UP000005640; Chromosome 17.
Bgee; ENSG00000181856; -.
CleanEx; HS_SLC2A4; -.
ExpressionAtlas; P14672; baseline and differential.
Genevisible; P14672; HS.
GO; GO:0005905; C:clathrin-coated pit; IEA:Ensembl.
GO; GO:0030136; C:clathrin-coated vesicle; IDA:UniProtKB.
GO; GO:0030659; C:cytoplasmic vesicle membrane; IEA:Ensembl.
GO; GO:0005829; C:cytosol; IEA:Ensembl.
GO; GO:0012505; C:endomembrane system; ISS:UniProtKB.
GO; GO:0009897; C:external side of plasma membrane; IDA:MGI.
GO; GO:0070062; C:extracellular exosome; IEA:Ensembl.
GO; GO:0032593; C:insulin-responsive compartment; IDA:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IEA:Ensembl.
GO; GO:0016020; C:membrane; TAS:ProtInc.
GO; GO:0045121; C:membrane raft; IEA:Ensembl.
GO; GO:0005771; C:multivesicular body; IEA:Ensembl.
GO; GO:0048471; C:perinuclear region of cytoplasm; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IDA:UniProtKB.
GO; GO:0030315; C:T-tubule; IEA:Ensembl.
GO; GO:0030140; C:trans-Golgi network transport vesicle; IEA:Ensembl.
GO; GO:0012506; C:vesicle membrane; IDA:MGI.
GO; GO:0055056; F:D-glucose transmembrane transporter activity; TAS:Reactome.
GO; GO:0005355; F:glucose transmembrane transporter activity; TAS:ProtInc.
GO; GO:0010021; P:amylopectin biosynthetic process; IEA:Ensembl.
GO; GO:0050873; P:brown fat cell differentiation; IEA:Ensembl.
GO; GO:0005975; P:carbohydrate metabolic process; TAS:ProtInc.
GO; GO:0071456; P:cellular response to hypoxia; IEA:Ensembl.
GO; GO:0032869; P:cellular response to insulin stimulus; IDA:UniProtKB.
GO; GO:0071470; P:cellular response to osmotic stress; IEA:Ensembl.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IEA:Ensembl.
GO; GO:0042593; P:glucose homeostasis; IDA:BHF-UCL.
GO; GO:0046323; P:glucose import; NAS:BHF-UCL.
GO; GO:0044381; P:glucose import in response to insulin stimulus; IEA:Ensembl.
GO; GO:1904659; P:glucose transmembrane transport; TAS:UniProtKB.
GO; GO:0045471; P:response to ethanol; IEA:Ensembl.
CDD; cd06174; MFS; 1.
InterPro; IPR002441; Glc_transpt_4.
InterPro; IPR020846; MFS_dom.
InterPro; IPR005828; MFS_sugar_transport-like.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR003663; Sugar/inositol_transpt.
InterPro; IPR005829; Sugar_transporter_CS.
Pfam; PF00083; Sugar_tr; 1.
PRINTS; PR01193; GLUCTRSPORT4.
PRINTS; PR00171; SUGRTRNSPORT.
SUPFAM; SSF103473; SSF103473; 1.
TIGRFAMs; TIGR00879; SP; 1.
PROSITE; PS50850; MFS; 1.
PROSITE; PS00216; SUGAR_TRANSPORT_1; 1.
PROSITE; PS00217; SUGAR_TRANSPORT_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome; Cytoplasm;
Diabetes mellitus; Disease mutation; Glycoprotein; Membrane;
Phosphoprotein; Polymorphism; Reference proteome; Sugar transport;
Transmembrane; Transmembrane helix; Transport; Ubl conjugation.
CHAIN 1 509 Solute carrier family 2, facilitated
glucose transporter member 4.
/FTId=PRO_0000050363.
TOPO_DOM 1 24 Cytoplasmic. {ECO:0000255}.
TRANSMEM 25 45 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 46 81 Extracellular. {ECO:0000255}.
TRANSMEM 82 102 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 103 111 Cytoplasmic. {ECO:0000255}.
TRANSMEM 112 132 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 133 142 Extracellular. {ECO:0000255}.
TRANSMEM 143 163 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 164 171 Cytoplasmic. {ECO:0000255}.
TRANSMEM 172 192 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 193 201 Extracellular. {ECO:0000255}.
TRANSMEM 202 222 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 223 287 Cytoplasmic. {ECO:0000255}.
TRANSMEM 288 308 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 309 323 Extracellular. {ECO:0000255}.
TRANSMEM 324 344 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 345 353 Cytoplasmic. {ECO:0000255}.
TRANSMEM 354 374 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 375 384 Extracellular. {ECO:0000255}.
TRANSMEM 385 405 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 406 417 Cytoplasmic. {ECO:0000255}.
TRANSMEM 418 438 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 439 445 Extracellular. {ECO:0000255}.
TRANSMEM 446 466 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 467 509 Cytoplasmic. {ECO:0000255}.
REGION 7 13 SRFBP1-binding.
REGION 298 304 Monosaccharide binding. {ECO:0000250}.
MOTIF 489 490 Dileucine internalization motif.
BINDING 333 333 Monosaccharide. {ECO:0000250}.
BINDING 404 404 Monosaccharide. {ECO:0000250}.
MOD_RES 10 10 Phosphoserine.
{ECO:0000250|UniProtKB:P19357}.
MOD_RES 274 274 Phosphoserine; by SGK1.
{ECO:0000269|PubMed:17382906}.
MOD_RES 486 486 Phosphothreonine.
{ECO:0000250|UniProtKB:P14142}.
MOD_RES 488 488 Phosphoserine.
{ECO:0000250|UniProtKB:P14142}.
CARBOHYD 57 57 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:19349973}.
VAR_SEQ 342 415 LLVERAGRRTLHLLGLAGMCGCAILMTVALLLLERVPAMSY
VSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGP -> TAHL
WNGPSHWLHLPGCPGGVVGGAGGAPDAPSPGPGGHVWLCHP
DDCGSAPAGASSSHELRLHCGHLWLRGIF (in isoform
2). {ECO:0000303|PubMed:15489334}.
/FTId=VSP_056331.
VAR_SEQ 416 509 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_056332.
VARIANT 55 55 S -> R (in dbSNP:rs35198331).
/FTId=VAR_052503.
VARIANT 78 78 T -> S (in dbSNP:rs5434).
/FTId=VAR_012060.
VARIANT 358 358 A -> V (in dbSNP:rs8192702).
/FTId=VAR_020336.
VARIANT 383 383 V -> I (in NIDDM; dbSNP:rs121434581).
{ECO:0000269|PubMed:1521731,
ECO:0000269|PubMed:1756912,
ECO:0000269|PubMed:1918382}.
/FTId=VAR_007170.
VARIANT 385 385 I -> T (in dbSNP:rs775242206).
{ECO:0000269|PubMed:1397719}.
/FTId=VAR_007171.
MUTAGEN 489 490 LL->AA: Changes subcellular location
mainly to the plasma membrane.
{ECO:0000269|PubMed:8300557}.
CONFLICT 151 154 Missing (in Ref. 2; AAA52569).
{ECO:0000305}.
SEQUENCE 509 AA; 54787 MW; 8E20CD97562C1EBF CRC64;
MPSGFQQIGS EDGEPPQQRV TGTLVLAVFS AVLGSLQFGY NIGVINAPQK VIEQSYNETW
LGRQGPEGPS SIPPGTLTTL WALSVAIFSV GGMISSFLIG IISQWLGRKR AMLVNNVLAV
LGGSLMGLAN AAASYEMLIL GRFLIGAYSG LTSGLVPMYV GEIAPTHLRG ALGTLNQLAI
VIGILIAQVL GLESLLGTAS LWPLLLGLTV LPALLQLVLL PFCPESPRYL YIIQNLEGPA
RKSLKRLTGW ADVSGVLAEL KDEKRKLERE RPLSLLQLLG SRTHRQPLII AVVLQLSQQL
SGINAVFYYS TSIFETAGVG QPAYATIGAG VVNTVFTLVS VLLVERAGRR TLHLLGLAGM
CGCAILMTVA LLLLERVPAM SYVSIVAIFG FVAFFEIGPG PIPWFIVAEL FSQGPRPAAM
AVAGFSNWTS NFIIGMGFQY VAEAMGPYVF LLFAVLLLGF FIFTFLRVPE TRGRTFDQIS
AAFHRTPSLL EQEVKPSTEL EYLGPDEND


Related products :

Catalog number Product name Quantity
U2023m CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023m CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023r CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023r CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023p ELISA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
U2023p CLIA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
E2023p ELISA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
U2023p CLIA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Pig,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4,Sus scrofa 96T
U2023b CLIA kit Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023b ELISA kit Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023b ELISA Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023b CLIA Bos taurus,Bovine,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023h ELISA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023h CLIA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023h ELISA Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023h CLIA kit Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,Homo sapiens,Human,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023c CLIA B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023c CLIA kit B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023c ELISA B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023c ELISA kit B146,Canis familiaris,Canis lupus familiaris,Dog,Glucose transporter type 4, insulin-responsive,GLUT4,GLUT-4,SLC2A4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E1185h ELISA kit Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur