Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Solute carrier family 2, facilitated glucose transporter member 9 (Glucose transporter type 9) (GLUT-9)

 GTR9_HUMAN              Reviewed;         540 AA.
Q9NRM0; Q0VGC4; Q4W5D1; Q8WV30; Q96P00;
16-NOV-2001, integrated into UniProtKB/Swiss-Prot.
13-JUL-2010, sequence version 2.
22-NOV-2017, entry version 148.
RecName: Full=Solute carrier family 2, facilitated glucose transporter member 9;
AltName: Full=Glucose transporter type 9;
Short=GLUT-9;
Name=SLC2A9; Synonyms=GLUT9;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANTS ARG-25 AND
LEU-350.
TISSUE=Kidney;
PubMed=10860667; DOI=10.1006/geno.2000.6195;
Phay J.E., Hussain H.B., Moley J.F.;
"Cloning and expression analysis of a novel member of the facilitative
glucose transporter family, SLC2A9 (GLUT9).";
Genomics 66:217-220(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), AND
VARIANTS ARG-25 AND LEU-350.
TISSUE=Lung, and Ovary;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
NUCLEOTIDE SEQUENCE [MRNA] OF 85-238 (ISOFORM 1), AND TISSUE
SPECIFICITY.
TISSUE=Articular cartilage;
PubMed=11991658; DOI=10.1006/cbir.2001.0850;
Mobasheri A., Neama G., Bell S., Richardson S., Carter S.D.;
"Human articular chondrocytes express three facilitative glucose
transporter isoforms: GLUT1, GLUT3 and GLUT9.";
Cell Biol. Int. 26:297-300(2002).
[5]
FUNCTION, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY (ISOFORMS 1 AND
2).
PubMed=14739288; DOI=10.1074/jbc.M312226200;
Augustin R., Carayannopoulos M.O., Dowd L.O., Phay J.E., Moley J.F.,
Moley K.H.;
"Identification and characterization of human glucose transporter-like
protein-9 (GLUT9): alternative splicing alters trafficking.";
J. Biol. Chem. 279:16229-16236(2004).
[6]
INVOLVEMENT IN THE REGULATION OF SERUM URIC ACID CONCENTRATION, AND
VARIANTS ASP-191; HIS-281; ILE-282 AND LEU-350.
PubMed=18327256; DOI=10.1038/ng.107;
Doering A., Gieger C., Mehta D., Gohlke H., Prokisch H., Coassin S.,
Fischer G., Henke K., Klopp N., Kronenberg F., Paulweber B.,
Pfeufer A., Rosskopf D., Voelzke H., Illig T., Meitinger T.,
Wichmann H.-E., Meisinger C.;
"SLC2A9 influences uric acid concentrations with pronounced sex-
specific effects.";
Nat. Genet. 40:430-436(2008).
[7]
INVOLVEMENT IN THE REGULATION OF SERUM URIC ACID CONCENTRATION,
FUNCTION, AND VARIANTS ASN-22; ARG-216; MET-275; HIS-281 AND HIS-300.
PubMed=18327257; DOI=10.1038/ng.106;
Vitart V., Rudan I., Hayward C., Gray N.K., Floyd J., Palmer C.N.,
Knott S.A., Kolcic I., Polasek O., Graessler J., Wilson J.F.,
Marinaki A., Riches P.L., Shu X., Janicijevic B., Smolej-Narancic N.,
Gorgoni B., Morgan J., Campbell S., Biloglav Z., Barac-Lauc L.,
Pericic M., Klaric I.M., Zgaga L., Skaric-Juric T., Wild S.H.,
Richardson W.A., Hohenstein P., Kimber C.H., Tenesa A., Donnelly L.A.,
Fairbanks L.D., Aringer M., McKeigue P.M., Ralston S.H., Morris A.D.,
Rudan P., Hastie N.D., Campbell H., Wright A.F.;
"SLC2A9 is a newly identified urate transporter influencing serum
urate concentration, urate excretion and gout.";
Nat. Genet. 40:437-442(2008).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9 AND SER-515, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[9]
SUBCELLULAR LOCATION (ISOFORMS 1 AND 2), AND TISSUE SPECIFICITY.
PubMed=24409316; DOI=10.1371/journal.pone.0084996;
Kimura T., Takahashi M., Yan K., Sakurai H.;
"Expression of SLC2A9 isoforms in the kidney and their localization in
polarized epithelial cells.";
PLoS ONE 9:E84996-E84996(2014).
[10]
VARIANTS RHUC2 CYS-198 AND TRP-380, AND CHARACTERIZATION OF VARIANTS
RHUC2 CYS-198 AND TRP-380.
PubMed=19026395; DOI=10.1016/j.ajhg.2008.11.001;
Matsuo H., Chiba T., Nagamori S., Nakayama A., Domoto H., Phetdee K.,
Wiriyasermkul P., Kikuchi Y., Oda T., Nishiyama J., Nakamura T.,
Morimoto Y., Kamakura K., Sakurai Y., Nonoyama S., Kanai Y.,
Shinomiya N.;
"Mutations in glucose transporter 9 gene SLC2A9 cause renal
hypouricemia.";
Am. J. Hum. Genet. 83:744-751(2008).
[11]
ERRATUM.
Matsuo H., Chiba T., Nagamori S., Nakayama A., Domoto H., Phetdee K.,
Wiriyasermkul P., Kikuchi Y., Oda T., Nishiyama J., Nakamura T.,
Morimoto Y., Kamakura K., Sakurai Y., Nonoyama S., Kanai Y.,
Shinomiya N.;
Am. J. Hum. Genet. 83:795-795(2008).
[12]
VARIANT RHUC2 ARG-75, AND CHARACTERIZATION OF VARIANT RHUC2 ARG-75.
PubMed=19926891; DOI=10.1681/ASN.2009040406;
Dinour D., Gray N.K., Campbell S., Shu X., Sawyer L., Richardson W.,
Rechavi G., Amariglio N., Ganon L., Sela B.A., Bahat H., Goldman M.,
Weissgarten J., Millar M.R., Wright A.F., Holtzman E.J.;
"Homozygous SLC2A9 mutations cause severe renal hypouricemia.";
J. Am. Soc. Nephrol. 21:64-72(2010).
[13]
VARIANTS RHUC2 MET-125 AND CYS-171, AND CHARACTERIZATION OF VARIANTS
RHUC2 MET-125 AND CYS-171.
PubMed=21810765; DOI=10.1093/ndt/gfr419;
Dinour D., Gray N.K., Ganon L., Knox A.J., Shalev H., Sela B.A.,
Campbell S., Sawyer L., Shu X., Valsamidou E., Landau D., Wright A.F.,
Holtzman E.J.;
"Two novel homozygous SLC2A9 mutations cause renal hypouricemia type
2.";
Nephrol. Dial. Transplant. 27:1035-1041(2012).
[14]
CHARACTERIZATION OF VARIANTS ARG-25; MET-169; MET-275; HIS-281;
ILE-282; HIS-294 AND LEU-350.
PubMed=25268603; DOI=10.1371/journal.pone.0107902;
Hurba O., Mancikova A., Krylov V., Pavlikova M., Pavelka K.,
Stiburkova B.;
"Complex analysis of urate transporters SLC2A9, SLC22A12 and
functional characterization of non-synonymous allelic variants of
GLUT9 in the Czech population: no evidence of effect on hyperuricemia
and gout.";
PLoS ONE 9:E107902-E107902(2014).
-!- FUNCTION: Transport urate and fructose. May have a role in the
urate reabsorption by proximal tubules. Also transports glucose at
low rate. {ECO:0000269|PubMed:14739288,
ECO:0000269|PubMed:18327257}.
-!- SUBCELLULAR LOCATION: Isoform 1: Basolateral cell membrane
{ECO:0000269|PubMed:14739288, ECO:0000269|PubMed:24409316}; Multi-
pass membrane protein {ECO:0000269|PubMed:14739288}.
-!- SUBCELLULAR LOCATION: Isoform 2: Apical cell membrane
{ECO:0000269|PubMed:24409316}; Multi-pass membrane protein.
Basolateral cell membrane {ECO:0000269|PubMed:14739288,
ECO:0000269|PubMed:24409316}; Multi-pass membrane protein
{ECO:0000269|PubMed:14739288}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=SLC2A9-L;
IsoId=Q9NRM0-1; Sequence=Displayed;
Name=2; Synonyms=GLUT9deltaN, SLC2A9-S;
IsoId=Q9NRM0-2; Sequence=VSP_034860;
Note=Variant in position: 17:A->T (in dbSNP:6820230).;
-!- TISSUE SPECIFICITY: Most strongly expressed in basolateral
membranes of proximal renal tubular cells, liver and placenta.
Also detected in lung, blood leukocytes, heart skeletal muscle and
chondrocytes from articular cartilage. Isoform 2 is only detected
in the apical membranes of polarized renal tubular cells and
placenta. Isoform 1 and isoform 2 are detected in kidney membrane
(at protein level). {ECO:0000269|PubMed:11991658,
ECO:0000269|PubMed:24409316}.
-!- POLYMORPHISM: Genetic variations in SLC2A9 influence the variance
in serum uric acid concentrations and define the serum uric acid
concentration quantitative trait locus 2 (UAQTL2) [MIM:612076].
Excess serum accumulation of uric acid can lead to the development
of gout.
-!- DISEASE: Hypouricemia renal 2 (RHUC2) [MIM:612076]: A disorder
characterized by impaired uric acid reabsorption at the apical
membrane of proximal renal tubule cells, and high urinary urate
excretion. Patients often appear asymptomatic, but may be subject
to exercise-induced acute renal failure, chronic renal dysfunction
and nephrolithiasis. {ECO:0000269|PubMed:19026395,
ECO:0000269|PubMed:19926891, ECO:0000269|PubMed:21810765}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- SIMILARITY: Belongs to the major facilitator superfamily. Sugar
transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF210317; AAF85942.1; -; mRNA.
EMBL; AC005674; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC098976; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC108199; AAY41052.1; -; Genomic_DNA.
EMBL; BC018897; AAH18897.1; -; mRNA.
EMBL; BC110414; AAI10415.1; -; mRNA.
EMBL; AF421859; AAL16939.1; -; mRNA.
CCDS; CCDS3406.1; -. [Q9NRM0-2]
CCDS; CCDS3407.1; -. [Q9NRM0-1]
RefSeq; NP_001001290.1; NM_001001290.1. [Q9NRM0-2]
RefSeq; NP_064425.2; NM_020041.2. [Q9NRM0-1]
UniGene; Hs.444612; -.
UniGene; Hs.656895; -.
ProteinModelPortal; Q9NRM0; -.
BioGrid; 121156; 43.
STRING; 9606.ENSP00000264784; -.
ChEMBL; CHEMBL2052034; -.
DrugBank; DB09502; Fludeoxyglucose F-18.
DrugBank; DB00678; Losartan.
DrugBank; DB01032; Probenecid.
DrugBank; DB08844; Uric Acid.
TCDB; 2.A.1.1.72; the major facilitator superfamily (mfs).
iPTMnet; Q9NRM0; -.
PhosphoSitePlus; Q9NRM0; -.
BioMuta; SLC2A9; -.
DMDM; 300669647; -.
PaxDb; Q9NRM0; -.
PeptideAtlas; Q9NRM0; -.
PRIDE; Q9NRM0; -.
DNASU; 56606; -.
Ensembl; ENST00000264784; ENSP00000264784; ENSG00000109667. [Q9NRM0-1]
Ensembl; ENST00000309065; ENSP00000311383; ENSG00000109667. [Q9NRM0-2]
Ensembl; ENST00000506583; ENSP00000422209; ENSG00000109667. [Q9NRM0-2]
GeneID; 56606; -.
KEGG; hsa:56606; -.
UCSC; uc003gmc.4; human. [Q9NRM0-1]
CTD; 56606; -.
DisGeNET; 56606; -.
EuPathDB; HostDB:ENSG00000109667.11; -.
GeneCards; SLC2A9; -.
H-InvDB; HIX0004090; -.
HGNC; HGNC:13446; SLC2A9.
HPA; HPA066229; -.
MalaCards; SLC2A9; -.
MIM; 606142; gene.
MIM; 612076; phenotype.
neXtProt; NX_Q9NRM0; -.
OpenTargets; ENSG00000109667; -.
Orphanet; 94088; Hereditary renal hypouricemia.
PharmGKB; PA37771; -.
eggNOG; KOG0569; Eukaryota.
eggNOG; COG0477; LUCA.
GeneTree; ENSGT00760000119022; -.
HOGENOM; HOG000202871; -.
HOVERGEN; HBG014816; -.
InParanoid; Q9NRM0; -.
KO; K08146; -.
OMA; GLNAIWY; -.
OrthoDB; EOG091G0A9K; -.
PhylomeDB; Q9NRM0; -.
TreeFam; TF313762; -.
Reactome; R-HSA-189200; Cellular hexose transport.
Reactome; R-HSA-5619047; Defective SLC2A9 causes hypouricemia renal 2 (RHUC2).
GeneWiki; SLC2A9; -.
GenomeRNAi; 56606; -.
PRO; PR:Q9NRM0; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000109667; -.
CleanEx; HS_SLC2A9; -.
ExpressionAtlas; Q9NRM0; baseline and differential.
Genevisible; Q9NRM0; HS.
GO; GO:0016324; C:apical plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0016323; C:basolateral plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0005355; F:glucose transmembrane transporter activity; IEA:Ensembl.
GO; GO:0005351; F:sugar:proton symporter activity; NAS:UniProtKB.
GO; GO:0022857; F:transmembrane transporter activity; TAS:Reactome.
GO; GO:0015143; F:urate transmembrane transporter activity; IDA:UniProtKB.
GO; GO:0015758; P:glucose transport; NAS:UniProtKB.
GO; GO:0008645; P:hexose transport; TAS:Reactome.
GO; GO:0046415; P:urate metabolic process; IMP:UniProtKB.
CDD; cd06174; MFS; 1.
InterPro; IPR020846; MFS_dom.
InterPro; IPR005828; MFS_sugar_transport-like.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR003663; Sugar/inositol_transpt.
InterPro; IPR005829; Sugar_transporter_CS.
Pfam; PF00083; Sugar_tr; 1.
PRINTS; PR00171; SUGRTRNSPORT.
SUPFAM; SSF103473; SSF103473; 2.
TIGRFAMs; TIGR00879; SP; 1.
PROSITE; PS50850; MFS; 1.
PROSITE; PS00216; SUGAR_TRANSPORT_1; 1.
PROSITE; PS00217; SUGAR_TRANSPORT_2; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disease mutation; Glycoprotein; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Sugar transport; Transmembrane;
Transmembrane helix; Transport.
CHAIN 1 540 Solute carrier family 2, facilitated
glucose transporter member 9.
/FTId=PRO_0000050378.
TOPO_DOM 1 51 Cytoplasmic. {ECO:0000255}.
TRANSMEM 52 72 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 73 107 Extracellular. {ECO:0000255}.
TRANSMEM 108 128 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 129 140 Cytoplasmic. {ECO:0000255}.
TRANSMEM 141 161 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 162 171 Extracellular. {ECO:0000255}.
TRANSMEM 172 192 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 193 200 Cytoplasmic. {ECO:0000255}.
TRANSMEM 201 221 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 222 231 Extracellular. {ECO:0000255}.
TRANSMEM 232 252 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 253 316 Cytoplasmic. {ECO:0000255}.
TRANSMEM 317 337 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 338 354 Extracellular. {ECO:0000255}.
TRANSMEM 355 375 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 376 381 Cytoplasmic. {ECO:0000255}.
TRANSMEM 382 402 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 403 415 Extracellular. {ECO:0000255}.
TRANSMEM 416 436 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 437 451 Cytoplasmic. {ECO:0000255}.
TRANSMEM 452 472 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 473 478 Extracellular. {ECO:0000255}.
TRANSMEM 479 499 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 500 540 Cytoplasmic. {ECO:0000255}.
REGION 327 333 Monosaccharide binding. {ECO:0000250}.
MOD_RES 9 9 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
MOD_RES 515 515 Phosphoserine.
{ECO:0000244|PubMed:24275569}.
CARBOHYD 90 90 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 50 MARKQNRNSKELGLVPLTDDTSHAGPPGPGRALLECDHLRS
GVPGGRRRK -> MKLSKKDRGEDEESDSAKKKL (in
isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_034860.
VARIANT 22 22 S -> N. {ECO:0000269|PubMed:18327257}.
/FTId=VAR_045648.
VARIANT 25 25 G -> R (polymorphism; no effect on urate
transport activity; dbSNP:rs2276961).
{ECO:0000269|PubMed:10860667,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:25268603}.
/FTId=VAR_012157.
VARIANT 75 75 L -> R (in RHUC2; reduced urate transport
activity; dbSNP:rs863225072).
{ECO:0000269|PubMed:19926891}.
/FTId=VAR_065772.
VARIANT 125 125 T -> M (in RHUC2; markedly reduced urate
transport activity; dbSNP:rs181509591).
{ECO:0000269|PubMed:21810765}.
/FTId=VAR_065773.
VARIANT 169 169 V -> M (polymorphism; no effect on urate
transport activity; dbSNP:rs144196049).
{ECO:0000269|PubMed:25268603}.
/FTId=VAR_075343.
VARIANT 171 171 R -> C (in RHUC2; markedly reduced urate
transport activity; dbSNP:rs776127501).
{ECO:0000269|PubMed:21810765}.
/FTId=VAR_065774.
VARIANT 191 191 E -> D (in dbSNP:rs376990050).
{ECO:0000269|PubMed:18327256}.
/FTId=VAR_045649.
VARIANT 198 198 R -> C (in RHUC2; markedly reduced urate
transport activity; dbSNP:rs121908322).
{ECO:0000269|PubMed:19026395}.
/FTId=VAR_065775.
VARIANT 216 216 G -> R (in dbSNP:rs561633150).
{ECO:0000269|PubMed:18327257}.
/FTId=VAR_045650.
VARIANT 275 275 T -> M (polymorphism; no effect on urate
transport activity; dbSNP:rs112404957).
{ECO:0000269|PubMed:18327257,
ECO:0000269|PubMed:25268603}.
/FTId=VAR_045651.
VARIANT 281 281 D -> H (polymorphism; no effect on urate
transport activity; dbSNP:rs73225891).
{ECO:0000269|PubMed:18327256,
ECO:0000269|PubMed:18327257,
ECO:0000269|PubMed:25268603}.
/FTId=VAR_045652.
VARIANT 282 282 V -> I (polymorphism; no effect on urate
transport activity; dbSNP:rs16890979).
{ECO:0000269|PubMed:18327256,
ECO:0000269|PubMed:25268603}.
/FTId=VAR_012158.
VARIANT 294 294 R -> H (polymorphism; no effect on urate
transport activity; dbSNP:rs3733591).
{ECO:0000269|PubMed:25268603}.
/FTId=VAR_020337.
VARIANT 300 300 R -> H (in dbSNP:rs145688560).
{ECO:0000269|PubMed:18327257}.
/FTId=VAR_045653.
VARIANT 350 350 P -> L (polymorphism; no effect on urate
transport activity; dbSNP:rs2280205).
{ECO:0000269|PubMed:10860667,
ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:18327256,
ECO:0000269|PubMed:25268603}.
/FTId=VAR_012159.
VARIANT 380 380 R -> W (in RHUC2; markedly reduced urate
transport activity; dbSNP:rs121908321).
{ECO:0000269|PubMed:19026395}.
/FTId=VAR_065776.
SEQUENCE 540 AA; 58702 MW; EEA40123DB5233B4 CRC64;
MARKQNRNSK ELGLVPLTDD TSHAGPPGPG RALLECDHLR SGVPGGRRRK DWSCSLLVAS
LAGAFGSSFL YGYNLSVVNA PTPYIKAFYN ESWERRHGRP IDPDTLTLLW SVTVSIFAIG
GLVGTLIVKM IGKVLGRKHT LLANNGFAIS AALLMACSLQ AGAFEMLIVG RFIMGIDGGV
ALSVLPMYLS EISPKEIRGS LGQVTAIFIC IGVFTGQLLG LPELLGKEST WPYLFGVIVV
PAVVQLLSLP FLPDSPRYLL LEKHNEARAV KAFQTFLGKA DVSQEVEEVL AESRVQRSIR
LVSVLELLRA PYVRWQVVTV IVTMACYQLC GLNAIWFYTN SIFGKAGIPP AKIPYVTLST
GGIETLAAVF SGLVIEHLGR RPLLIGGFGL MGLFFGTLTI TLTLQDHAPW VPYLSIVGIL
AIIASFCSGP GGIPFILTGE FFQQSQRPAA FIIAGTVNWL SNFAVGLLFP FIQKSLDTYC
FLVFATICIT GAIYLYFVLP ETKNRTYAEI SQAFSKRNKA YPPEEKIDSA VTDGKINGRP


Related products :

Catalog number Product name Quantity
E1185h ELISA Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185h ELISA kit Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185h CLIA Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,HepG2 glucose transporter,Homo sapiens,Human,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1635r ELISA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Rat,Rattus norvegicus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1635m ELISA kit Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Mouse,Mus musculus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1185b ELISA Bos taurus,Bovine,Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,GLUT-I,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1635m ELISA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Mouse,Mus musculus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
E1635r ELISA kit Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Rat,Rattus norvegicus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
U1185r CLIA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,Rat,Rattus norvegicus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185b ELISA kit Bos taurus,Bovine,Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,GLUT-I,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1185b CLIA Bos taurus,Bovine,Glucose transporter type 1, erythrocyte_brain,GLUT1,GLUT-1,GLUT-I,SLC2A1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185m ELISA kit Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,GT1,Mouse,Mus musculus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185r ELISA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,Rat,Rattus norvegicus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185m ELISA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,GT1,Mouse,Mus musculus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
E1185r ELISA kit Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,Rat,Rattus norvegicus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U1635r CLIA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Rat,Rattus norvegicus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
U1635m CLIA Glucose transporter type 3, brain,Glut3,GLUT-3,Glut-3,Mouse,Mus musculus,Slc2a3,Solute carrier family 2, facilitated glucose transporter member 3 96T
U1185m CLIA Glucose transporter type 1, erythrocyte_brain,Glut1,GLUT-1,Glut-1,GT1,Mouse,Mus musculus,Slc2a1,Solute carrier family 2, facilitated glucose transporter member 1 96T
U2023r CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023r CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023m CLIA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023m ELISA kit Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
E2023r ELISA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,Rat,Rattus norvegicus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T
U2023m CLIA Glucose transporter type 4, insulin-responsive,Glut4,GLUT-4,Glut-4,GT2,Mouse,Mus musculus,Slc2a4,Solute carrier family 2, facilitated glucose transporter member 4 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur