Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Solute carrier organic anion transporter family member 1B3 (Liver-specific organic anion transporter 2) (LST-2) (Organic anion transporter 8) (Organic anion-transporting polypeptide 8) (OATP-8) (Solute carrier family 21 member 8)

 SO1B3_HUMAN             Reviewed;         702 AA.
Q9NPD5; E7EMT8; Q5JAR4;
10-JAN-2003, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
25-OCT-2017, entry version 151.
RecName: Full=Solute carrier organic anion transporter family member 1B3;
AltName: Full=Liver-specific organic anion transporter 2;
Short=LST-2;
AltName: Full=Organic anion transporter 8;
AltName: Full=Organic anion-transporting polypeptide 8;
Short=OATP-8;
AltName: Full=Solute carrier family 21 member 8;
Name=SLCO1B3; Synonyms=LST2, OATP1B3, OATP8, SLC21A8;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), AND
GLYCOSYLATION.
TISSUE=Liver;
PubMed=10779507; DOI=10.1074/jbc.M001448200;
Koenig J., Cui Y., Nies A.T., Keppler D.;
"Localization and genomic organization of a new hepatocellular organic
anion transporting polypeptide.";
J. Biol. Chem. 275:23161-23168(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Liver;
PubMed=11375950; DOI=10.1053/gast.2001.24804;
Abe T., Unno M., Onogawa T., Tokui T., Kondo T.N., Nakagomi R.,
Adachi H., Fujiwara K., Okabe M., Suzuki T., Nunoki K., Sato E.,
Kakyo M., Nishio T., Sugita J., Asano N., Tanemoto M., Seki M.,
Date F., Ono K., Kondo Y., Shiiba K., Suzuki M., Ohtani H.,
Shimosegawa T., Iinuma K., Nagura H., Ito S., Matsuno S.;
"LST-2, a human liver-specific organic anion transporter, determines
methotrexate sensitivity in gastrointestinal cancers.";
Gastroenterology 120:1689-1699(2001).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Mizutamari H., Abe T.;
"Molecular identification of LST-3 subtype.";
Submitted (OCT-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16541075; DOI=10.1038/nature04569;
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y.,
Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C.,
Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M.,
Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B.,
Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D.,
Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z.,
Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z.,
Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H.,
Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H.,
Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V.,
Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J.,
Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A.,
Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M.,
Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E.,
Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K.,
Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D.,
Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M.,
Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R.,
Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J.,
Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C.,
Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M.,
Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M.,
Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P.,
Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L.,
Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E.,
Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C.,
Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F.,
Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M.,
Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S.,
Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J.,
Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A.,
Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M.,
Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I.,
Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A.,
Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D.,
Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I.,
Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T.,
Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S.,
Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D.,
Kucherlapati R., Weinstock G., Gibbs R.A.;
"The finished DNA sequence of human chromosome 12.";
Nature 440:346-351(2006).
[5]
FUNCTION, AND INVOLVEMENT IN HBLRR.
PubMed=22232210; DOI=10.1172/JCI59526;
van de Steeg E., Stranecky V., Hartmannova H., Noskova L.,
Hrebicek M., Wagenaar E., van Esch A., de Waart D.R.,
Oude Elferink R.P., Kenworthy K.E., Sticova E., al-Edreesi M.,
Knisely A.S., Kmoch S., Jirsa M., Schinkel A.H.;
"Complete OATP1B1 and OATP1B3 deficiency causes human Rotor syndrome
by interrupting conjugated bilirubin reuptake into the liver.";
J. Clin. Invest. 122:519-528(2012).
[6]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[7]
VARIANTS [LARGE SCALE ANALYSIS] MET-292 AND LEU-647.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
-!- FUNCTION: Mediates the Na(+)-independent uptake of organic anions
such as 17-beta-glucuronosyl estradiol, taurocholate,
triiodothyronine (T3), leukotriene C4, dehydroepiandrosterone
sulfate (DHEAS), methotrexate and sulfobromophthalein (BSP).
Involved in the clearance of bile acids and organic anions from
the liver. {ECO:0000269|PubMed:22232210}.
-!- SUBCELLULAR LOCATION: Basolateral cell membrane; Multi-pass
membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9NPD5-1; Sequence=Displayed;
Name=2;
IsoId=Q9NPD5-2; Sequence=VSP_056615, VSP_056616, VSP_056617;
-!- TISSUE SPECIFICITY: Highly expressed in liver, in particular at
the basolateral membrane of hepatocytes near the central vein. Not
detected in other tissues. Highly expressed in some cancer cell
lines derived from colon, pancreas, liver and gall bladder.
-!- PTM: N-glycosylated. {ECO:0000269|PubMed:10779507}.
-!- DISEASE: Hyperbilirubinemia, Rotor type (HBLRR) [MIM:237450]: An
autosomal recessive form of primary conjugated hyperbilirubinemia.
Affected individuals develop mild jaundice not associated with
hemolysis shortly after birth or in childhood. They have delayed
plasma clearance of the unconjugated anionic dye bromsulphthalein
and prominent urinary excretion of coproporphyrin I. Hepatic
pigmentation is normal. {ECO:0000269|PubMed:22232210}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- SIMILARITY: Belongs to the organo anion transporter (TC 2.A.60)
family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AJ400763; CAB97008.1; -; Genomic_DNA.
EMBL; AJ400764; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400765; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400766; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400767; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400768; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400769; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400770; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400771; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400772; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400773; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400774; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400775; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ400776; CAB97008.1; JOINED; Genomic_DNA.
EMBL; AJ251506; CAB96997.1; -; mRNA.
EMBL; AF187815; AAG43445.1; -; mRNA.
EMBL; AY257471; AAP81212.1; -; mRNA.
EMBL; AY442326; AAS01768.1; -; mRNA.
EMBL; AC011604; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC087309; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS8684.1; -. [Q9NPD5-1]
RefSeq; NP_062818.1; NM_019844.3. [Q9NPD5-1]
UniGene; Hs.504966; -.
ProteinModelPortal; Q9NPD5; -.
STRING; 9606.ENSP00000261196; -.
BindingDB; Q9NPD5; -.
ChEMBL; CHEMBL1743121; -.
DrugBank; DB06403; Ambrisentan.
DrugBank; DB01076; Atorvastatin.
DrugBank; DB06772; Cabazitaxel.
DrugBank; DB00520; Caspofungin.
DrugBank; DB08862; Cholecystokinin.
DrugBank; DB02659; Cholic Acid.
DrugBank; DB01211; Clarithromycin.
DrugBank; DB05239; Cobimetinib.
DrugBank; DB00286; Conjugated Equine Estrogens.
DrugBank; DB08912; Dabrafenib.
DrugBank; DB09102; Daclatasvir.
DrugBank; DB05804; dehydroepiandrosterone sulfate.
DrugBank; DB00390; Digoxin.
DrugBank; DB01248; Docetaxel.
DrugBank; DB00783; Estradiol.
DrugBank; DB00950; Fexofenadine.
DrugBank; DB01095; Fluvastatin.
DrugBank; DB08884; Gadoxetic acid.
DrugBank; DB11575; Grazoprevir.
DrugBank; DB09054; Idelalisib.
DrugBank; DB13153; Levomenol.
DrugBank; DB13139; Levosalbutamol.
DrugBank; DB00451; Levothyroxine.
DrugBank; DB00279; Liothyronine.
DrugBank; DB01583; Liotrix.
DrugBank; DB00563; Methotrexate.
DrugBank; DB00688; Mycophenolate mofetil.
DrugBank; DB02691; N-Cholylglycine.
DrugBank; DB00275; Olmesartan.
DrugBank; DB01092; Ouabain.
DrugBank; DB01229; Paclitaxel.
DrugBank; DB13154; Parachlorophenol.
DrugBank; DB01132; Pioglitazone.
DrugBank; DB08860; Pitavastatin.
DrugBank; DB00175; Pravastatin.
DrugBank; DB01045; Rifampicin.
DrugBank; DB08864; Rilpivirine.
DrugBank; DB06176; Romidepsin.
DrugBank; DB01098; Rosuvastatin.
DrugBank; DB09292; Sacubitril.
DrugBank; DB11362; Selexipag.
DrugBank; DB04348; Taurocholic Acid.
DrugBank; DB09137; Technetium Tc 99m Mebrofenin.
DrugBank; DB00177; Valsartan.
GuidetoPHARMACOLOGY; 1221; -.
TCDB; 2.A.60.1.12; the organo anion transporter (oat) family.
iPTMnet; Q9NPD5; -.
PhosphoSitePlus; Q9NPD5; -.
BioMuta; SLCO1B3; -.
DMDM; 27734563; -.
PaxDb; Q9NPD5; -.
PeptideAtlas; Q9NPD5; -.
PRIDE; Q9NPD5; -.
DNASU; 28234; -.
Ensembl; ENST00000261196; ENSP00000261196; ENSG00000111700. [Q9NPD5-1]
Ensembl; ENST00000381545; ENSP00000370956; ENSG00000111700. [Q9NPD5-1]
GeneID; 28234; -.
KEGG; hsa:28234; -.
UCSC; uc001rel.5; human. [Q9NPD5-1]
CTD; 28234; -.
DisGeNET; 28234; -.
EuPathDB; HostDB:ENSG00000111700.12; -.
GeneCards; SLCO1B3; -.
GeneReviews; SLCO1B3; -.
HGNC; HGNC:10961; SLCO1B3.
HPA; HPA004943; -.
HPA; HPA050892; -.
MalaCards; SLCO1B3; -.
MIM; 237450; phenotype.
MIM; 605495; gene.
neXtProt; NX_Q9NPD5; -.
OpenTargets; ENSG00000111700; -.
OpenTargets; ENSG00000257046; -.
Orphanet; 3111; Rotor syndrome.
PharmGKB; PA35844; -.
eggNOG; KOG3626; Eukaryota.
eggNOG; ENOG410XRSF; LUCA.
GeneTree; ENSGT00760000119014; -.
HOGENOM; HOG000231269; -.
HOVERGEN; HBG063896; -.
InParanoid; Q9NPD5; -.
KO; K05043; -.
OMA; CNLDMQD; -.
OrthoDB; EOG091G08QD; -.
PhylomeDB; Q9NPD5; -.
TreeFam; TF317540; -.
Reactome; R-HSA-159418; Recycling of bile acids and salts.
Reactome; R-HSA-879518; Transport of organic anions.
GeneWiki; SLCO1B3; -.
GenomeRNAi; 28234; -.
PRO; PR:Q9NPD5; -.
Proteomes; UP000005640; Chromosome 12.
Bgee; ENSG00000111700; -.
CleanEx; HS_SLCO1B3; -.
ExpressionAtlas; Q9NPD5; baseline and differential.
Genevisible; Q9NPD5; HS.
GO; GO:0016323; C:basolateral plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; IDA:HPA.
GO; GO:0015125; F:bile acid transmembrane transporter activity; IBA:GO_Central.
GO; GO:0008514; F:organic anion transmembrane transporter activity; TAS:ProtInc.
GO; GO:0015347; F:sodium-independent organic anion transmembrane transporter activity; IBA:GO_Central.
GO; GO:0015721; P:bile acid and bile salt transport; TAS:Reactome.
GO; GO:0015711; P:organic anion transport; TAS:ProtInc.
GO; GO:0043252; P:sodium-independent organic anion transport; IBA:GO_Central.
CDD; cd06174; MFS; 1.
InterPro; IPR002350; Kazal_dom.
InterPro; IPR036058; Kazal_dom_sf.
InterPro; IPR020846; MFS_dom.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR004156; OA_transporter.
PANTHER; PTHR11388; PTHR11388; 1.
Pfam; PF07648; Kazal_2; 1.
Pfam; PF03137; OATP; 1.
SUPFAM; SSF100895; SSF100895; 1.
SUPFAM; SSF103473; SSF103473; 5.
TIGRFAMs; TIGR00805; oat; 1.
PROSITE; PS51465; KAZAL_2; 1.
PROSITE; PS50850; MFS; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; Glycoprotein; Ion transport; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Transmembrane; Transmembrane helix;
Transport.
CHAIN 1 702 Solute carrier organic anion transporter
family member 1B3.
/FTId=PRO_0000191053.
TOPO_DOM 1 28 Cytoplasmic. {ECO:0000255}.
TRANSMEM 29 48 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 49 67 Extracellular. {ECO:0000255}.
TRANSMEM 68 88 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 89 94 Cytoplasmic. {ECO:0000255}.
TRANSMEM 95 119 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 120 168 Extracellular. {ECO:0000255}.
TRANSMEM 169 197 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 198 216 Cytoplasmic. {ECO:0000255}.
TRANSMEM 217 237 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 238 255 Extracellular. {ECO:0000255}.
TRANSMEM 256 280 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 281 331 Cytoplasmic. {ECO:0000255}.
TRANSMEM 332 353 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 354 373 Extracellular. {ECO:0000255}.
TRANSMEM 374 397 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 398 401 Cytoplasmic. {ECO:0000255}.
TRANSMEM 402 425 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 426 537 Extracellular. {ECO:0000255}.
TRANSMEM 538 560 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 561 569 Cytoplasmic. {ECO:0000255}.
TRANSMEM 570 595 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 596 629 Extracellular. {ECO:0000255}.
TRANSMEM 630 647 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 648 695 Cytoplasmic. {ECO:0000255}.
DOMAIN 453 508 Kazal-like. {ECO:0000255|PROSITE-
ProRule:PRU00798}.
MOD_RES 293 293 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Y6L6}.
MOD_RES 295 295 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Y6L6}.
MOD_RES 683 683 Phosphoserine.
{ECO:0000250|UniProtKB:Q9Y6L6}.
CARBOHYD 134 134 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 145 145 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 151 151 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 445 445 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 503 503 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 516 516 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 459 485 {ECO:0000255|PROSITE-ProRule:PRU00798}.
DISULFID 463 474 {ECO:0000255|PROSITE-ProRule:PRU00798}.
DISULFID 465 489 {ECO:0000255|PROSITE-ProRule:PRU00798}.
VAR_SEQ 622 664 GRVYLGLSIALRFPALVLYIVFIFAMKKKFQGKDTKASDNE
RK -> GIVQPELKALAIGFHSMIMRSLGGILVPIYFGALI
DTTCMKWSTNSCGARGACRIYNSTYLGRAFFGLKVALIFPV
LVLLTVFIFVVRKKSHGKDTKVLENERQ (in isoform
2). {ECO:0000303|Ref.3}.
/FTId=VSP_056615.
VAR_SEQ 676 677 NG -> DS (in isoform 2).
{ECO:0000303|Ref.3}.
/FTId=VSP_056616.
VAR_SEQ 685 702 GTDSKTCNLDMQDNAAAN -> EEQ (in isoform 2).
{ECO:0000303|Ref.3}.
/FTId=VSP_056617.
VARIANT 112 112 S -> A (in dbSNP:rs4149117).
/FTId=VAR_024645.
VARIANT 233 233 M -> I (in dbSNP:rs7311358).
/FTId=VAR_053672.
VARIANT 256 256 G -> A (in dbSNP:rs60140950).
/FTId=VAR_062150.
VARIANT 292 292 I -> M (in a colorectal cancer sample;
somatic mutation).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036410.
VARIANT 560 560 V -> A (in dbSNP:rs12299012).
/FTId=VAR_053673.
VARIANT 647 647 M -> L (in a colorectal cancer sample;
somatic mutation; dbSNP:rs556554798).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036411.
SEQUENCE 702 AA; 77403 MW; 6D2AE371D782C7FB CRC64;
MDQHQHLNKT AESASSEKKK TRRCNGFKMF LAALSFSYIA KALGGIIMKI SITQIERRFD
ISSSLAGLID GSFEIGNLLV IVFVSYFGSK LHRPKLIGIG CLLMGTGSIL TSLPHFFMGY
YRYSKETHIN PSENSTSSLS TCLINQTLSF NGTSPEIVEK DCVKESGSHM WIYVFMGNML
RGIGETPIVP LGISYIDDFA KEGHSSLYLG SLNAIGMIGP VIGFALGSLF AKMYVDIGYV
DLSTIRITPK DSRWVGAWWL GFLVSGLFSI ISSIPFFFLP KNPNKPQKER KISLSLHVLK
TNDDRNQTAN LTNQGKNVTK NVTGFFQSLK SILTNPLYVI FLLLTLLQVS SFIGSFTYVF
KYMEQQYGQS ASHANFLLGI ITIPTVATGM FLGGFIIKKF KLSLVGIAKF SFLTSMISFL
FQLLYFPLIC ESKSVAGLTL TYDGNNSVAS HVDVPLSYCN SECNCDESQW EPVCGNNGIT
YLSPCLAGCK SSSGIKKHTV FYNCSCVEVT GLQNRNYSAH LGECPRDNTC TRKFFIYVAI
QVINSLFSAT GGTTFILLTV KIVQPELKAL AMGFQSMVIR TLGGILAPIY FGALIDKTCM
KWSTNSCGAQ GACRIYNSVF FGRVYLGLSI ALRFPALVLY IVFIFAMKKK FQGKDTKASD
NERKVMDEAN LEFLNNGEHF VPSAGTDSKT CNLDMQDNAA AN


Related products :

Catalog number Product name Quantity
EIAAB39151 Homo sapiens,Human,Liver-specific organic anion transporter 2,LST2,LST-2,OATP1B3,OATP-8,OATP8,SLC21A8,Organic anion transporter 8,Organic anion-transporting polypeptide 8,SLCO1B3,Solute carrier family
EIAAB39152 Mouse,Mus musculus,OATP-14,Oatp1c1,OATP2,Oatpf,OATP-F,Organic anion transporter 2,Organic anion transporter F,Organic anion-transporting polypeptide 14,Slc21a14,Slco1c1,Solute carrier family 21 member
EIAAB39145 Mouse,Mus musculus,Oatp1a5,Oatp3,OATP-3,Organic anion-transporting polypeptide 3,Slc21a7,Slco1a5,Sodium-independent organic anion transporter 3,Solute carrier family 21 member 7,Solute carrier organic
EIAAB39149 Liver-specific organic anion transporter 1,Oatp1b2,OATP-4,Rat,Rattus norvegicus,rLST-1,Slc21a10,Slco1b2,Sodium-independent organic anion-transporting polypeptide 4,Solute carrier family 21 member 10,S
EIAAB39147 Kidney-specific organic anion-transporting polypeptide 5,Oatp5,OATP-5,Rat,Rattus norvegicus,Slc21a13,Slco1a6,Solute carrier family 21 member 13,Solute carrier organic anion transporter family member 1
EIAAB39146 Kidney-specific organic anion-transporting polypeptide 5,Mouse,Mus musculus,Oatp5,OATP-5,Slc21a13,Slco1a6,Solute carrier family 21 member 13,Solute carrier organic anion transporter family member 1A6
EIAAB39167 Oatp4a1,Oatpe,OATP-E,Organic anion-transporting polypeptide E,Rat,Rattus norvegicus,Slc21a12,Slco4a1,Sodium-independent organic anion transporter E,Solute carrier family 21 member 12,Solute carrier or
EIAAB39139 Mouse,Mus musculus,OATP-1,Oatp1a1,Slc21a1,Slco1a1,Sodium-independent organic anion-transporting polypeptide 1,Solute carrier family 21 member 1,Solute carrier organic anion transporter family member 1
EIAAB39165 Mouse,Mus musculus,Oatp4a1,Oatpe,OATP-E,Organic anion-transporting polypeptide E,Slc21a12,Slco4a1,Sodium-independent organic anion transporter E,Solute carrier family 21 member 12,Solute carrier organ
EIAAB39162 MJAM,Mouse,Mus musculus,Oatp3a1,Oatpd,OATP-D,Organic anion-transporting polypeptide D,Slc21a11,Slco3a1,Sodium-independent organic anion transporter D,Solute carrier family 21 member 11,Solute carrier
EIAAB39138 Oatp1,OATP-1,Oatp1a1,Organic anion-transporting polypeptide 1,Rat,Rattus norvegicus,Slc21a1,Slco1a1,Sodium-independent organic anion transporter 1,Solute carrier family 21 member 1,Solute carrier orga
EIAAB39163 Bos taurus,Bovine,OATP3A1,OATPD,OATP-D,Organic anion-transporting polypeptide D,SLC21A11,SLCO3A1,Solute carrier organic anion transporter family member 3A1
EIAAB39140 Homo sapiens,Human,OATP,OATP1,OATP-1,OATP1A2,OATP-A,Organic anion-transporting polypeptide 1,SLC21A3,SLCO1A2,Sodium-independent organic anion transporter,Solute carrier family 21 member 3,Solute carri
EIAAB39171 Homo sapiens,Human,OATP5A1,OATPRP4,OATP-RP4,Organic anion transporter polypeptide-related protein 4,SLC21A15,SLCO5A1,Solute carrier family 21 member 15,Solute carrier organic anion transporter family
EIAAB39144 Oatp1a5,Oatp3,OATP-3,Organic anion-transporting polypeptide 3,Rat,Rattus norvegicus,Slc21a7,Slco1a2,Slco1a5,Sodium-independent organic anion transporter 3,Solute carrier family 21 member 7,Solute carr
EIAAB39159 Homo sapiens,Human,KIAA0880,OATP2B1,OATPB,OATP-B,OATPRP2,OATP-RP2,Organic anion transporter B,Organic anion transporter polypeptide-related protein 2,SLC21A9,SLCO2B1,Solute carrier family 21 member 9,
EIAAB39150 Liver-specific organic anion transporter 1,LST-1,Mouse,Mus musculus,Oatp1b2,Slc21a10,SLC21A6,Slco1b2,Solute carrier family 21 member 10,Solute carrier organic anion transporter family member 1B2
EIAAB39168 Homo sapiens,Human,OATP4C1,OATP-H,OATP-M1,OATPX,Organic anion transporter M1,SLC21A20,SLCO4C1,Solute carrier family 21 member 20,Solute carrier organic anion transporter family member 4C1
EIAAB39143 Mouse,Mus musculus,Oatp1a4,Oatp2,Slc21a5,Slco1a4,Sodium-independent organic anion-transporting polypeptide 2,Solute carrier family 21 member 5,Solute carrier organic anion transporter family member 1A
EIAAB39148 Homo sapiens,Human,Liver-specific organic anion transporter 1,LST1,LST-1,OATP1B1,OATP2,OATP-2,OATPC,OATP-C,SLC21A6,SLCO1B1,Sodium-independent organic anion-transporting polypeptide 2,Solute carrier fa
EIAAB39141 OAT-K1,OAT-K2,Oatp1a3,Rat,Rattus norvegicus,rOAT-K,Slc21a4,Slco1a3,Sodium-independent organic anion transporter K1,Solute carrier family 21 member 4,Solute carrier organic anion transporter family mem
EIAAB36713 hOAT1,Homo sapiens,hPAHT,hROAT1,Human,OAT1,Organic anion transporter 1,PAH transporter,PAHT,Renal organic anion transporter 1,SLC22A6,Solute carrier family 22 member 6
EIAAB36711 Bos taurus,Bovine,OAT1,Organic anion transporter 1,Renal organic anion transporter 1,ROAT1,SLC22A6,Solute carrier family 22 member 6
EIAAB36716 OAT1,Organic anion transporter 1,Pig,pOAT1,Renal organic anion transporter 1,ROAT1,SLC22A6,Solute carrier family 22 member 6,Sus scrofa
EIAAB36714 Oat1,Organic anion transporter 1,Rat,Rattus norvegicus,renal organic anion transporter 1,rOAT1,rROAT1,Slc22a6,Solute carrier family 22 member 6


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur