Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Solute carrier organic anion transporter family member 4A1 (OATP4A1) (Colon organic anion transporter) (Organic anion transporter polypeptide-related protein 1) (OATP-RP1) (OATPRP1) (POAT) (Organic anion-transporting polypeptide E) (OATP-E) (Sodium-independent organic anion transporter E) (Solute carrier family 21 member 12)

 SO4A1_HUMAN             Reviewed;         722 AA.
Q96BD0; Q9H4T7; Q9H4T8; Q9H8P2; Q9NWX8; Q9UI35; Q9UIG7;
10-JAN-2003, integrated into UniProtKB/Swiss-Prot.
10-JAN-2003, sequence version 2.
31-JAN-2018, entry version 154.
RecName: Full=Solute carrier organic anion transporter family member 4A1;
Short=OATP4A1;
AltName: Full=Colon organic anion transporter;
AltName: Full=Organic anion transporter polypeptide-related protein 1;
Short=OATP-RP1;
Short=OATPRP1;
Short=POAT;
AltName: Full=Organic anion-transporting polypeptide E;
Short=OATP-E;
AltName: Full=Sodium-independent organic anion transporter E;
AltName: Full=Solute carrier family 21 member 12;
Name=SLCO4A1; Synonyms=OATP1, OATP4A1, OATPE, SLC21A12;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Kidney;
PubMed=10873595; DOI=10.1006/bbrc.2000.2922;
Tamai I., Nezu J., Uchino H., Sai Y., Oku A., Shimane M., Tsuji A.;
"Molecular identification and characterization of novel members of the
human organic anion transporter (OATP) family.";
Biochem. Biophys. Res. Commun. 273:251-260(2000).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Hippocampus;
PubMed=11316767; DOI=10.1210/endo.142.5.8115;
Fujiwara K., Adachi H., Nishio T., Unno M., Tokui T., Okabe M.,
Onogawa T., Suzuki T., Asano N., Tanemoto M., Seki M., Shiiba K.,
Suzuki M., Kondo Y., Nunoki K., Shimosegawa T., Iinuma K., Ito S.,
Matsuno S., Abe T.;
"Identification of thyroid hormone transporters in humans: different
molecules are involved in a tissue-specific manner.";
Endocrinology 142:2005-2012(2001).
[3]
NUCLEOTIDE SEQUENCE (ISOFORM 3).
Itoh S., Coca-Prados M., Lu R., Chan B.S., Schuster V.L.;
"Molecular cloning of a putative organic anion transporter, POAT.";
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE (ISOFORM 1).
Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G.;
"Identification and characterization of novel human OATP family
members.";
Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), AND VARIANT
ILE-78.
TISSUE=Ovarian carcinoma;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=11780052; DOI=10.1038/414865a;
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R.,
Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L.,
Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M.,
Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M., Brown A.J.,
Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P.,
Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M.,
Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R.,
Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M.,
Ellington A.G., Frankland J.A., Fraser A., French L., Garner P.,
Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E.,
Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J.,
Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D.,
Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S.,
Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D.,
Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A.,
Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T.,
Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I.,
Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H.,
Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S.,
Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E.,
Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A.,
Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M.,
Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A.,
Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S.,
Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 20.";
Nature 414:865-871(2001).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Pancreas;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18691976; DOI=10.1016/j.molcel.2008.07.007;
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R.,
Greff Z., Keri G., Stemmann O., Mann M.;
"Kinase-selective enrichment enables quantitative phosphoproteomics of
the kinome across the cell cycle.";
Mol. Cell 31:438-448(2008).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; THR-37; SER-40;
SER-43; SER-46 AND SER-50, AND IDENTIFICATION BY MASS SPECTROMETRY
[LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-43; SER-46 AND
SER-50, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; SER-40 AND SER-43,
AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
-!- FUNCTION: Mediates the Na(+)-independent transport of organic
anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4
(thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.
-!- SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Comment=Experimental confirmation may be lacking for some
isoforms.;
Name=1;
IsoId=Q96BD0-1; Sequence=Displayed;
Name=2;
IsoId=Q96BD0-2; Sequence=VSP_006152, VSP_006156;
Name=3;
IsoId=Q96BD0-3; Sequence=VSP_006153, VSP_006155;
Name=4;
IsoId=Q96BD0-4; Sequence=VSP_006154;
-!- TISSUE SPECIFICITY: Ubiquitous, with the exception of spleen and
leukocytes.
-!- SIMILARITY: Belongs to the organo anion transporter (TC 2.A.60)
family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAA91247.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB031051; BAA89288.1; -; mRNA.
EMBL; AF187817; AAG43447.1; -; mRNA.
EMBL; AF104334; AAF15545.1; -; mRNA.
EMBL; AF205072; AAG42204.1; -; mRNA.
EMBL; AK023410; BAB14566.1; -; mRNA.
EMBL; AK000551; BAA91247.1; ALT_INIT; mRNA.
EMBL; AL357033; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC015727; AAH15727.1; -; mRNA.
CCDS; CCDS13501.1; -. [Q96BD0-1]
RefSeq; NP_057438.3; NM_016354.3. [Q96BD0-1]
UniGene; Hs.235782; -.
ProteinModelPortal; Q96BD0; -.
BioGrid; 118180; 4.
IntAct; Q96BD0; 6.
STRING; 9606.ENSP00000217159; -.
ChEMBL; CHEMBL2073679; -.
DrugBank; DB01053; Benzylpenicillin.
DrugBank; DB00286; Conjugated Equine Estrogens.
DrugBank; DB00509; Dextrothyroxine.
DrugBank; DB00390; Digoxin.
DrugBank; DB00917; Dinoprostone.
DrugBank; DB00783; Estradiol.
DrugBank; DB00451; Levothyroxine.
DrugBank; DB00279; Liothyronine.
DrugBank; DB01583; Liotrix.
DrugBank; DB04348; Taurocholic Acid.
MEROPS; I01.972; -.
TCDB; 2.A.60.1.9; the organo anion transporter (oat) family.
iPTMnet; Q96BD0; -.
PhosphoSitePlus; Q96BD0; -.
SwissPalm; Q96BD0; -.
BioMuta; SLCO4A1; -.
DMDM; 27734555; -.
MaxQB; Q96BD0; -.
PaxDb; Q96BD0; -.
PeptideAtlas; Q96BD0; -.
PRIDE; Q96BD0; -.
DNASU; 28231; -.
Ensembl; ENST00000217159; ENSP00000217159; ENSG00000101187. [Q96BD0-1]
Ensembl; ENST00000370507; ENSP00000359538; ENSG00000101187. [Q96BD0-1]
GeneID; 28231; -.
KEGG; hsa:28231; -.
UCSC; uc002ydb.1; human. [Q96BD0-1]
CTD; 28231; -.
DisGeNET; 28231; -.
EuPathDB; HostDB:ENSG00000101187.15; -.
GeneCards; SLCO4A1; -.
H-InvDB; HIX0015985; -.
H-InvDB; HIX0138058; -.
HGNC; HGNC:10953; SLCO4A1.
HPA; HPA030669; -.
HPA; HPA030670; -.
MIM; 612436; gene.
neXtProt; NX_Q96BD0; -.
OpenTargets; ENSG00000101187; -.
PharmGKB; PA35838; -.
eggNOG; KOG3626; Eukaryota.
eggNOG; ENOG410XRSF; LUCA.
GeneTree; ENSGT00760000119014; -.
HOVERGEN; HBG100565; -.
InParanoid; Q96BD0; -.
KO; K14354; -.
OMA; KVWIGAW; -.
OrthoDB; EOG091G02FX; -.
PhylomeDB; Q96BD0; -.
TreeFam; TF317540; -.
Reactome; R-HSA-879518; Transport of organic anions.
ChiTaRS; SLCO4A1; human.
GeneWiki; SLCO4A1; -.
GenomeRNAi; 28231; -.
PRO; PR:Q96BD0; -.
Proteomes; UP000005640; Chromosome 20.
Bgee; ENSG00000101187; -.
CleanEx; HS_SLCO4A1; -.
ExpressionAtlas; Q96BD0; baseline and differential.
Genevisible; Q96BD0; HS.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0015347; F:sodium-independent organic anion transmembrane transporter activity; IBA:GO_Central.
GO; GO:0015349; F:thyroid hormone transmembrane transporter activity; IBA:GO_Central.
GO; GO:0043252; P:sodium-independent organic anion transport; IBA:GO_Central.
GO; GO:0070327; P:thyroid hormone transport; IBA:GO_Central.
CDD; cd06174; MFS; 1.
InterPro; IPR002350; Kazal_dom.
InterPro; IPR036058; Kazal_dom_sf.
InterPro; IPR020846; MFS_dom.
InterPro; IPR036259; MFS_trans_sf.
InterPro; IPR004156; OATP.
PANTHER; PTHR11388; PTHR11388; 1.
Pfam; PF07648; Kazal_2; 1.
Pfam; PF03137; OATP; 1.
SUPFAM; SSF100895; SSF100895; 1.
SUPFAM; SSF103473; SSF103473; 3.
TIGRFAMs; TIGR00805; oat; 1.
PROSITE; PS51465; KAZAL_2; 1.
PROSITE; PS50850; MFS; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; Glycoprotein; Ion transport; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Transmembrane; Transmembrane helix;
Transport.
CHAIN 1 722 Solute carrier organic anion transporter
family member 4A1.
/FTId=PRO_0000191067.
TOPO_DOM 1 103 Cytoplasmic. {ECO:0000255}.
TRANSMEM 104 124 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 125 143 Extracellular. {ECO:0000255}.
TRANSMEM 144 164 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 165 170 Cytoplasmic. {ECO:0000255}.
TRANSMEM 171 195 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 196 222 Extracellular. {ECO:0000255}.
TRANSMEM 223 253 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 254 272 Cytoplasmic. {ECO:0000255}.
TRANSMEM 273 293 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 294 307 Extracellular. {ECO:0000255}.
TRANSMEM 308 332 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 333 378 Cytoplasmic. {ECO:0000255}.
TRANSMEM 379 400 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 401 420 Extracellular. {ECO:0000255}.
TRANSMEM 421 444 Helical; Name=8. {ECO:0000255}.
TOPO_DOM 445 448 Cytoplasmic. {ECO:0000255}.
TRANSMEM 449 471 Helical; Name=9. {ECO:0000255}.
TOPO_DOM 472 580 Extracellular. {ECO:0000255}.
TRANSMEM 581 603 Helical; Name=10. {ECO:0000255}.
TOPO_DOM 604 612 Cytoplasmic. {ECO:0000255}.
TRANSMEM 613 638 Helical; Name=11. {ECO:0000255}.
TOPO_DOM 639 671 Extracellular. {ECO:0000255}.
TRANSMEM 672 689 Helical; Name=12. {ECO:0000255}.
TOPO_DOM 690 722 Cytoplasmic. {ECO:0000255}.
DOMAIN 498 555 Kazal-like. {ECO:0000255|PROSITE-
ProRule:PRU00798}.
MOD_RES 34 34 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:23186163}.
MOD_RES 37 37 Phosphothreonine.
{ECO:0000244|PubMed:18669648}.
MOD_RES 40 40 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
MOD_RES 43 43 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
MOD_RES 46 46 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231}.
MOD_RES 50 50 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231}.
CARBOHYD 499 499 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 557 557 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 504 530 {ECO:0000255|PROSITE-ProRule:PRU00798}.
DISULFID 508 519 {ECO:0000255|PROSITE-ProRule:PRU00798}.
DISULFID 510 534 {ECO:0000255|PROSITE-ProRule:PRU00798}.
VAR_SEQ 250 410 TYLDENVKSSCSPVYIAIFYTAAILGPAAGYLIGGALLNIY
TEMGRRTELTTESPLWVGAWWVGFLGSGAAAFFTAVPILGY
PRQLPGSQRYAVMRAAEMHQLKDSSRGEASNPDFGKTIRDL
PLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFL ->
LFFAIACFLYKPLS (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_006152.
VAR_SEQ 548 661 YRDCSCIPQNLSSGFGHATAGKCTSTCQRKPLLLVFIFVVI
FFTFLSSIPALTATLRCVRDPQRSFALGIQWIVVRILGGIP
GPIAFGWVIDKACLLWQDQCGQQGSCLVYQNS -> SGAAA
YRPCPPLDPGKGPPCLPLVIGAIVGLPRCTETVAVSLRIFP
LVLAMHCREMHFNLSEKAPPSGFHIRCNFLYIPQQHSCTNG
NSTVSWGRVCACPELSLQHPEAELCRS (in isoform
3). {ECO:0000305}.
/FTId=VSP_006153.
VAR_SEQ 572 603 STCQRKPLLLVFIFVVIFFTFLSSIPALTATL -> TTALC
AARTASCTSHCATQGALQPRRRMWTAR (in isoform
4). {ECO:0000303|PubMed:14702039}.
/FTId=VSP_006154.
VAR_SEQ 662 722 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_006155.
VAR_SEQ 686 722 CFLYKPLSESSDGLETCLPSQSSAPDSATDSQLQSSV ->
SSRAASDHRPRPPGHGGHSAFPDDRTVPLGDAITRELLFDL
QPST (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_006156.
VARIANT 70 70 R -> Q (in dbSNP:rs34419428).
/FTId=VAR_053678.
VARIANT 78 78 V -> I (in dbSNP:rs1047099).
{ECO:0000269|PubMed:14702039}.
/FTId=VAR_053679.
CONFLICT 246 246 T -> M (in Ref. 5; BAB14566).
{ECO:0000305}.
SEQUENCE 722 AA; 77193 MW; DD8F0C10E4BCD255 CRC64;
MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS PLDTSKQPLC
QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN TPKGILFFLC AAAFLQGMTV
NGFINTVITS LERRYDLHSY QSGLIASSYD IAACLCLTFV SYFGGSGHKP RWLGWGVLLM
GTGSLVFALP HFTAGRYEVE LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG
ATPLYTLGVT YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT
TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH QLKDSSRGEA
SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT GMSTFSPKFL ESQFSLSASE
AATLFGYLVV PAGGGGTFLG GFFVNKLRLR GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP
MAGVTASYGG SLLPEGHLNL TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET
NVDGQKVYRD CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT
ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG QQGSCLVYQN
SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE TCLPSQSSAP DSATDSQLQS
SV


Related products :

Catalog number Product name Quantity
EIAAB39152 Mouse,Mus musculus,OATP-14,Oatp1c1,OATP2,Oatpf,OATP-F,Organic anion transporter 2,Organic anion transporter F,Organic anion-transporting polypeptide 14,Slc21a14,Slco1c1,Solute carrier family 21 member
EIAAB39166 Colon organic anion transporter,Homo sapiens,Human,OATP1,OATP4A1,OATP4A1,OATPE,OATP-E,OATPRP1,OATP-RP1,Organic anion transporter polypeptide-related protein 1,Organic anion-transporting polypeptide E,
EIAAB39167 Oatp4a1,Oatpe,OATP-E,Organic anion-transporting polypeptide E,Rat,Rattus norvegicus,Slc21a12,Slco4a1,Sodium-independent organic anion transporter E,Solute carrier family 21 member 12,Solute carrier or
EIAAB39165 Mouse,Mus musculus,Oatp4a1,Oatpe,OATP-E,Organic anion-transporting polypeptide E,Slc21a12,Slco4a1,Sodium-independent organic anion transporter E,Solute carrier family 21 member 12,Solute carrier organ
EIAAB39145 Mouse,Mus musculus,Oatp1a5,Oatp3,OATP-3,Organic anion-transporting polypeptide 3,Slc21a7,Slco1a5,Sodium-independent organic anion transporter 3,Solute carrier family 21 member 7,Solute carrier organic
EIAAB39140 Homo sapiens,Human,OATP,OATP1,OATP-1,OATP1A2,OATP-A,Organic anion-transporting polypeptide 1,SLC21A3,SLCO1A2,Sodium-independent organic anion transporter,Solute carrier family 21 member 3,Solute carri
EIAAB39151 Homo sapiens,Human,Liver-specific organic anion transporter 2,LST2,LST-2,OATP1B3,OATP-8,OATP8,SLC21A8,Organic anion transporter 8,Organic anion-transporting polypeptide 8,SLCO1B3,Solute carrier family
EIAAB39162 MJAM,Mouse,Mus musculus,Oatp3a1,Oatpd,OATP-D,Organic anion-transporting polypeptide D,Slc21a11,Slco3a1,Sodium-independent organic anion transporter D,Solute carrier family 21 member 11,Solute carrier
EIAAB39138 Oatp1,OATP-1,Oatp1a1,Organic anion-transporting polypeptide 1,Rat,Rattus norvegicus,Slc21a1,Slco1a1,Sodium-independent organic anion transporter 1,Solute carrier family 21 member 1,Solute carrier orga
EIAAB39144 Oatp1a5,Oatp3,OATP-3,Organic anion-transporting polypeptide 3,Rat,Rattus norvegicus,Slc21a7,Slco1a2,Slco1a5,Sodium-independent organic anion transporter 3,Solute carrier family 21 member 7,Solute carr
EIAAB39159 Homo sapiens,Human,KIAA0880,OATP2B1,OATPB,OATP-B,OATPRP2,OATP-RP2,Organic anion transporter B,Organic anion transporter polypeptide-related protein 2,SLC21A9,SLCO2B1,Solute carrier family 21 member 9,
EIAAB39149 Liver-specific organic anion transporter 1,Oatp1b2,OATP-4,Rat,Rattus norvegicus,rLST-1,Slc21a10,Slco1b2,Sodium-independent organic anion-transporting polypeptide 4,Solute carrier family 21 member 10,S
EIAAB39139 Mouse,Mus musculus,OATP-1,Oatp1a1,Slc21a1,Slco1a1,Sodium-independent organic anion-transporting polypeptide 1,Solute carrier family 21 member 1,Solute carrier organic anion transporter family member 1
EIAAB39171 Homo sapiens,Human,OATP5A1,OATPRP4,OATP-RP4,Organic anion transporter polypeptide-related protein 4,SLC21A15,SLCO5A1,Solute carrier family 21 member 15,Solute carrier organic anion transporter family
EIAAB39163 Bos taurus,Bovine,OATP3A1,OATPD,OATP-D,Organic anion-transporting polypeptide D,SLC21A11,SLCO3A1,Solute carrier organic anion transporter family member 3A1
EIAAB39154 Homo sapiens,Human,OATP14,OATP-14,OATP1C1,OATPF,OATP-F,OATPRP5,OAT-RP-5,Organic anion transporter F,Organic anion transporter polypeptide-related protein 5,Organic anion-transporting polypeptide 14,SL
EIAAB39148 Homo sapiens,Human,Liver-specific organic anion transporter 1,LST1,LST-1,OATP1B1,OATP2,OATP-2,OATPC,OATP-C,SLC21A6,SLCO1B1,Sodium-independent organic anion-transporting polypeptide 2,Solute carrier fa
EIAAB39147 Kidney-specific organic anion-transporting polypeptide 5,Oatp5,OATP-5,Rat,Rattus norvegicus,Slc21a13,Slco1a6,Solute carrier family 21 member 13,Solute carrier organic anion transporter family member 1
EIAAB39146 Kidney-specific organic anion-transporting polypeptide 5,Mouse,Mus musculus,Oatp5,OATP-5,Slc21a13,Slco1a6,Solute carrier family 21 member 13,Solute carrier organic anion transporter family member 1A6
EIAAB39143 Mouse,Mus musculus,Oatp1a4,Oatp2,Slc21a5,Slco1a4,Sodium-independent organic anion-transporting polypeptide 2,Solute carrier family 21 member 5,Solute carrier organic anion transporter family member 1A
EIAAB39168 Homo sapiens,Human,OATP4C1,OATP-H,OATP-M1,OATPX,Organic anion transporter M1,SLC21A20,SLCO4C1,Solute carrier family 21 member 20,Solute carrier organic anion transporter family member 4C1
EIAAB39161 Oatp3a1,Oatpd,OATP-D,Organic anion-transporting polypeptide D,Pgt2,Prostaglandin transporter subtype 2,Rat,Rattus norvegicus,Slc21a11,Slco3a1,Sodium-independent organic anion transporter D,Solute carr
EIAAB39142 Brain digoxin carrier protein,Brain-specific organic anion transporter,Oatp1a4,Oatp2,OATP-B1,Rat,Rattus norvegicus,Slc21a5,Slco1a4,Sodium-independent organic anion-transporting polypeptide 2,Solute ca
EIAAB39141 OAT-K1,OAT-K2,Oatp1a3,Rat,Rattus norvegicus,rOAT-K,Slc21a4,Slco1a3,Sodium-independent organic anion transporter K1,Solute carrier family 21 member 4,Solute carrier organic anion transporter family mem
EIAAB36713 hOAT1,Homo sapiens,hPAHT,hROAT1,Human,OAT1,Organic anion transporter 1,PAH transporter,PAHT,Renal organic anion transporter 1,SLC22A6,Solute carrier family 22 member 6


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur