Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Spike glycoprotein (S glycoprotein) (E2) (Peplomer protein) [Cleaved into: Spike protein S1 (90B); Spike protein S2 (90A)]

 SPIKE_CVHOC             Reviewed;        1353 AA.
P36334; Q66199; Q66290; Q66291; Q696Q6; Q6TNF9; Q86623;
01-JUN-1994, integrated into UniProtKB/Swiss-Prot.
01-JUN-1994, sequence version 1.
10-MAY-2017, entry version 105.
RecName: Full=Spike glycoprotein;
Short=S glycoprotein;
AltName: Full=E2;
AltName: Full=Peplomer protein;
Contains:
RecName: Full=Spike protein S1;
AltName: Full=90B;
Contains:
RecName: Full=Spike protein S2;
AltName: Full=90A;
Flags: Precursor;
Name=S; ORFNames=3;
Human coronavirus OC43 (HCoV-OC43).
Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage;
Nidovirales; Coronaviridae; Coronavirinae; Betacoronavirus.
NCBI_TaxID=31631;
NCBI_TaxID=9606; Homo sapiens (Human).
[1]
NUCLEOTIDE SEQUENCE [GENOMIC RNA].
PubMed=8376972; DOI=10.1099/0022-1317-74-9-1981;
Mounir S., Talbot P.J.;
"Molecular characterization of the S protein gene of human coronavirus
OC43.";
J. Gen. Virol. 74:1981-1987(1993).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC RNA].
PubMed=8317096; DOI=10.1006/viro.1993.1360;
Kuenkel F., Herrler G.;
"Structural and functional analysis of the surface protein of human
coronavirus OC43.";
Virology 195:195-202(1993).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC RNA].
STRAIN=Isolate AT, Isolate CU, and Isolate VA;
PubMed=8712929; DOI=10.1007/BF01718615;
Kuenkel F., Herrler G.;
"Structural and functional analysis of the S proteins of two human
coronavirus OC43 strains adapted to growth in different cells.";
Arch. Virol. 141:1123-1131(1996).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC RNA].
STRAIN=Isolate ATCC VR-759;
PubMed=15280490; DOI=10.1128/JVI.78.16.8824-8834.2004;
St Jean J.R., Jacomy H., Desforges M., Vabret A., Freymuth F.,
Talbot P.J.;
"Human respiratory coronavirus OC43: genetic stability and
neuroinvasion.";
J. Virol. 78:8824-8834(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC RNA].
STRAIN=Isolate ATCC VR-759;
PubMed=15650185; DOI=10.1128/JVI.79.3.1595-1604.2005;
Vijgen L., Keyaerts E., Moes E., Thoelen I., Wollants E., Lemey P.,
Vandamme A.M., Van Ranst M.;
"Complete genomic sequence of human coronavirus OC43: molecular clock
analysis suggests a relatively recent zoonotic coronavirus
transmission event.";
J. Virol. 79:1595-1604(2005).
[6]
REVIEW.
PubMed=11162792; DOI=10.1006/viro.2000.0757;
Gallagher T.M., Buchmeier M.J.;
"Coronavirus spike proteins in viral entry and pathogenesis.";
Virology 279:371-374(2001).
-!- FUNCTION: S1 attaches the virion to the cell membrane by
interacting with sialic acid-containing cell receptors, initiating
the infection.
-!- FUNCTION: S2 is a class I viral fusion protein. Under the current
model, the protein has at least 3 conformational states: pre-
fusion native state, pre-hairpin intermediate state, and post-
fusion hairpin state. During viral and target cell membrane
fusion, the coiled coil regions (heptad repeats) assume a trimer-
of-hairpins structure, positioning the fusion peptide in close
proximity to the C-terminal region of the ectodomain. The
formation of this structure appears to drive apposition and
subsequent fusion of viral and target cell membranes.
-!- SUBUNIT: Homotrimer; each monomer consists of a S1 and a S2
subunit. The resulting peplomers protrude from the virus surface
as spikes. During virus morphogenesis, it is found in a complex
with M and HE proteins (By similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Spike protein S2: Virion membrane
{ECO:0000250}; Single-pass type I membrane protein {ECO:0000250}.
Host endoplasmic reticulum-Golgi intermediate compartment membrane
{ECO:0000250}; Single-pass type I membrane protein {ECO:0000250}.
Note=Accumulates in the endoplasmic reticulum-Golgi intermediate
compartment, where it participates in virus particle assembly.
Some S oligomers may be transported to the plasma membrane, where
they may mediate cell-cell fusion (By similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Spike protein S1: Virion membrane
{ECO:0000250}; Peripheral membrane protein {ECO:0000250}. Host
endoplasmic reticulum-Golgi intermediate compartment membrane
{ECO:0000250}; Peripheral membrane protein {ECO:0000250}.
Note=Accumulates in the endoplasmic reticulum-Golgi intermediate
compartment, where it participates in virus particle assembly.
Some S oligomers may be transported to the plasma membrane, where
they may mediate cell-cell fusion. S1 is not anchored to the viral
envelope, but associates with the extravirion surface through its
binding to S2 (By similarity). {ECO:0000250}.
-!- PTM: Specific enzymatic cleavages in vivo yield mature proteins.
The precursor is processed into S1 and S2 by host cell furin or
furin-like protease to yield the mature S1 and S2 proteins. The
cleavage site between S1 and S2 requires the optimal sequence
[KR]-X-[KR]-R. Cleavage is not necessary for virus-cell fusion,
and fusion probably occurs at the host plasma membrane (By
similarity). {ECO:0000250}.
-!- SIMILARITY: Belongs to the coronaviruses spike protein family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAB27260.2; Type=Miscellaneous discrepancy; Note=Unknown reason.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; L14643; AAA03055.1; -; Genomic_RNA.
EMBL; S62886; AAB27260.2; ALT_SEQ; Genomic_RNA.
EMBL; Z21849; CAA79896.1; -; Genomic_RNA.
EMBL; Z32768; CAA83660.1; -; Genomic_RNA.
EMBL; Z32769; CAA83661.1; -; Genomic_RNA.
EMBL; AY585228; AAT84354.1; -; Genomic_RNA.
EMBL; AY391777; AAR01015.1; -; Genomic_RNA.
PIR; A37474; A37474.
PIR; JQ2168; JQ2168.
PIR; S29998; S29998.
PIR; S44240; S44240.
PIR; S44241; S44241.
ProteinModelPortal; P36334; -.
SMR; P36334; -.
OrthoDB; VOG0900000Z; -.
Proteomes; UP000007552; Genome.
GO; GO:0044173; C:host cell endoplasmic reticulum-Golgi intermediate compartment membrane; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0019031; C:viral envelope; NAS:UniProtKB.
GO; GO:0055036; C:virion membrane; IEA:UniProtKB-SubCell.
GO; GO:0030246; F:carbohydrate binding; NAS:UniProtKB.
GO; GO:0046789; F:host cell surface receptor binding; TAS:UniProtKB.
GO; GO:0019064; P:fusion of virus membrane with host plasma membrane; TAS:UniProtKB.
GO; GO:0009405; P:pathogenesis; TAS:UniProtKB.
GO; GO:0046813; P:receptor-mediated virion attachment to host cell; IEA:InterPro.
Gene3D; 1.20.5.790; -; 1.
InterPro; IPR002552; Corona_S2.
InterPro; IPR027400; S_HR2.
InterPro; IPR032500; Spike_N.
InterPro; IPR018548; Spike_rcpt-bd.
Pfam; PF01601; Corona_S2; 1.
Pfam; PF16451; Spike_NTD; 1.
Pfam; PF09408; Spike_rec_bind; 1.
SUPFAM; SSF143587; SSF143587; 1.
3: Inferred from homology;
Cleavage on pair of basic residues; Coiled coil; Complete proteome;
Fusion of virus membrane with host cell membrane;
Fusion of virus membrane with host membrane; Glycoprotein;
Host membrane; Host-virus interaction; Membrane; Signal;
Transmembrane; Transmembrane helix; Viral attachment to host cell;
Viral envelope protein; Viral penetration into host cytoplasm; Virion;
Virulence; Virus entry into host cell.
SIGNAL 1 14 {ECO:0000255}.
CHAIN 15 1353 Spike glycoprotein.
/FTId=PRO_0000037205.
CHAIN 15 758 Spike protein S1. {ECO:0000255}.
/FTId=PRO_0000037206.
CHAIN 759 1353 Spike protein S2. {ECO:0000255}.
/FTId=PRO_0000037207.
TOPO_DOM 15 1298 Extracellular. {ECO:0000255}.
TRANSMEM 1299 1318 Helical. {ECO:0000255}.
TOPO_DOM 1319 1353 Cytoplasmic. {ECO:0000255}.
REGION 963 983 Fusion peptide. {ECO:0000255}.
COILED 1033 1077 {ECO:0000255}.
COILED 1259 1287 {ECO:0000255}.
COMPBIAS 1319 1336 Cys-rich.
SITE 758 759 Cleavage; by host. {ECO:0000255}.
CARBOHYD 59 59 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 133 133 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 146 146 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 202 202 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 363 363 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 441 441 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 496 496 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 639 639 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 666 666 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 686 686 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 704 704 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 729 729 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 778 778 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 927 927 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 1184 1184 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 1214 1214 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 1224 1224 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 1243 1243 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 1257 1257 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
CARBOHYD 1278 1278 N-linked (GlcNAc...) asparagine; by host.
{ECO:0000255}.
VARIANT 11 13 TAF -> MAL (in strain: Isolate VA).
VARIANT 23 25 SDN -> TVA (in strain: Isolate VA).
VARIANT 23 25 SDN -> TVS (in strain: Isolate CU).
VARIANT 25 25 N -> TSY (in strain: Isolate AT and
Isolate ATCC VR-759).
VARIANT 29 29 K -> I (in strain: Isolate CU).
VARIANT 29 29 K -> V (in strain: Isolate VA).
VARIANT 33 36 PPPI -> VPST (in strain: Isolate VA).
VARIANT 33 35 PPP -> APS (in strain: Isolate CU).
VARIANT 40 40 T -> I (in strain: Isolate CU and Isolate
VA).
VARIANT 62 62 L -> F (in strain: Isolate AT).
VARIANT 63 63 F -> L (in strain: Isolate AT, Isolate CU
and Isolate VA).
VARIANT 83 84 SV -> TL (in strain: Isolate CU and
Isolate VA).
VARIANT 115 115 D -> H (in strain: Isolate VA).
VARIANT 115 115 D -> K (in strain: Isolate CU).
VARIANT 116 116 R -> G (in strain: Isolate AT, Isolate CU
and Isolate VA).
VARIANT 143 151 RTINSTQDG -> HTTNL (in strain: Isolate CU
and Isolate VA).
VARIANT 152 152 D -> Y (in strain: Isolate AT and Isolate
ATCC VR-759).
VARIANT 161 161 V -> I (in strain: Isolate CU and Isolate
VA).
VARIANT 167 167 N -> T (in strain: Isolate CU and Isolate
VA).
VARIANT 173 173 Q -> H (in strain: Isolate CU).
VARIANT 173 173 Q -> N (in strain: Isolate VA).
VARIANT 183 185 HRK -> RRV (in strain: Isolate CU and
Isolate VA).
VARIANT 190 190 L -> W (in strain: Isolate CU and Isolate
VA).
VARIANT 222 222 T -> I (in strain: Isolate VA).
VARIANT 244 245 MA -> TV (in strain: Isolate CU and
Isolate VA).
VARIANT 248 248 H -> Y (in strain: Isolate VA).
VARIANT 252 252 M -> L (in strain: Isolate CU).
VARIANT 259 260 KL -> AM (in strain: Isolate CU, Isolate
ATCC VR-759 and Isolate VA).
VARIANT 260 260 L -> VKNGF (in strain: Isolate AT and
Isolate ATCC VR-759).
VARIANT 272 272 R -> K (in strain: Isolate CU and Isolate
VA).
VARIANT 283 283 I -> V (in strain: Isolate CU and Isolate
VA).
VARIANT 288 288 E -> V (in strain: Isolate AT, Isolate
ATCC VR-759, Isolate CU and Isolate VA).
VARIANT 291 291 M -> K (in strain: Isolate CU and Isolate
VA).
VARIANT 303 303 Q -> L (in strain: Isolate CU and Isolate
VA).
VARIANT 308 308 P -> S (in strain: Isolate CU and Isolate
VA).
VARIANT 329 329 K -> I (in strain: Isolate CU and Isolate
VA).
VARIANT 330 330 P -> L (in strain: Isolate ATCC VR-759).
VARIANT 334 334 N -> D (in strain: Isolate CU and Isolate
VA).
VARIANT 451 451 T -> I (in strain: Isolate VA).
VARIANT 454 454 K -> R (in strain: Isolate CU and Isolate
VA).
VARIANT 459 461 IED -> TEQ (in strain: Isolate CU and
Isolate VA).
VARIANT 467 467 R -> Q (in strain: Isolate CU and Isolate
VA).
VARIANT 469 474 AGVLTN -> VGVFTH (in strain: Isolate CU).
VARIANT 472 474 LTN -> FTD (in strain: Isolate VA).
VARIANT 488 488 K -> T (in strain: Isolate CU and Isolate
VA).
VARIANT 496 496 N -> D (in strain: Isolate CU and Isolate
VA).
VARIANT 499 536 CVGSGPGKNNGIGTCPAGTNYLTCDNLCTPDPITFTGT ->
LCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCT
PDPITSKSTGP (in strain: Isolate CU and
Isolate VA).
VARIANT 533 533 F -> FKA (in strain: Isolate AT and
Isolate ATCC VR-759).
VARIANT 544 544 S -> Y (in strain: Isolate CU and Isolate
VA).
VARIANT 557 557 V -> I (in strain: Isolate CU and Isolate
VA).
VARIANT 566 566 S -> P (in strain: Isolate AT, Isolate CU
and Isolate VA).
VARIANT 570 570 R -> Q (in strain: Isolate CU and Isolate
VA).
VARIANT 579 579 A -> V (in strain: Isolate CU and Isolate
VA).
VARIANT 587 587 K -> R (in strain: Isolate CU and Isolate
VA).
VARIANT 603 603 L -> T (in strain: Isolate CU and Isolate
VA).
VARIANT 612 612 A -> S (in strain: Isolate CU and Isolate
VA).
VARIANT 630 630 L -> T (in strain: Isolate CU and Isolate
VA).
VARIANT 641 641 T -> P (in strain: Isolate CU and Isolate
VA).
VARIANT 664 665 II -> LT (in strain: Isolate CU and
Isolate VA).
VARIANT 665 665 I -> T (in strain: Isolate AT and Isolate
ATCC VR-759).
VARIANT 694 694 F -> S (in strain: Isolate AT).
VARIANT 700 700 N -> S (in strain: Isolate CU).
VARIANT 706 708 SLT -> TLS (in strain: Isolate CU and
Isolate VA).
VARIANT 728 728 Y -> D (in strain: Isolate CU and Isolate
VA).
VARIANT 732 734 AIS -> SSV (in strain: Isolate CU).
VARIANT 733 734 IS -> SA (in strain: Isolate VA).
VARIANT 752 753 KN -> TK (in strain: Isolate CU and
Isolate VA).
VARIANT 758 758 G -> R (in strain: Isolate CU and Isolate
VA).
VARIANT 783 783 P -> H (in strain: Isolate VA).
VARIANT 802 802 V -> E (in strain: Isolate AT, Isolate
ATCC VR-759, Isolate CU and Isolate VA).
VARIANT 817 817 A -> S (in strain: Isolate CU and Isolate
VA).
VARIANT 824 824 Y -> C (in strain: Isolate VA).
VARIANT 833 833 E -> G (in strain: Isolate AT).
VARIANT 884 884 I -> V (in strain: Isolate VA).
VARIANT 896 896 E -> C (in strain: Isolate CU).
VARIANT 898 900 SKA -> NKV (in strain: Isolate CU and
Isolate VA).
VARIANT 912 912 D -> S (in strain: Isolate CU and Isolate
VA).
VARIANT 915 915 K -> R (in strain: Isolate VA).
VARIANT 933 933 E -> G (in strain: Isolate VA).
VARIANT 944 944 K -> N (in strain: Isolate CU and Isolate
VA).
VARIANT 955 955 E -> D (in strain: Isolate VA).
VARIANT 955 955 E -> V (in strain: Isolate CU).
VARIANT 969 969 S -> N (in strain: Isolate VA).
VARIANT 973 973 P -> L (in strain: Isolate ATCC VR-759).
VARIANT 975 975 T -> S (in strain: Isolate CU and Isolate
VA).
VARIANT 993 993 L -> I (in strain: Isolate CU and Isolate
VA).
VARIANT 1012 1012 N -> S (in strain: Isolate CU).
VARIANT 1016 1016 Y -> D (in strain: Isolate AT, Isolate CU
and Isolate VA).
VARIANT 1039 1039 N -> D (in strain: Isolate VA).
VARIANT 1058 1058 S -> G (in strain: Isolate CU).
VARIANT 1059 1059 A -> S (in strain: Isolate CU and Isolate
VA).
VARIANT 1074 1074 E -> Q (in strain: Isolate CU and Isolate
VA).
VARIANT 1089 1089 N -> D (in strain: Isolate VA).
VARIANT 1160 1160 R -> K (in strain: Isolate CU and Isolate
VA).
VARIANT 1189 1189 Y -> F (in strain: Isolate CU and Isolate
VA).
VARIANT 1193 1193 G -> R (in strain: Isolate VA).
VARIANT 1197 1197 P -> L (in strain: Isolate AT).
VARIANT 1202 1202 E -> G (in strain: Isolate CU and Isolate
VA).
VARIANT 1211 1211 C -> W (in strain: Isolate AT).
VARIANT 1220 1220 Y -> D (in strain: Isolate CU and Isolate
VA).
VARIANT 1225 1227 TSI -> IST (in strain: Isolate CU and
Isolate VA).
VARIANT 1231 1231 P -> H (in strain: Isolate CU).
VARIANT 1246 1246 S -> L (in strain: Isolate VA).
VARIANT 1265 1265 V -> D (in strain: Isolate CU and Isolate
VA).
VARIANT 1305 1306 CL -> GF (in strain: Isolate CU and
Isolate VA).
VARIANT 1331 1331 K -> I (in strain: Isolate CU).
VARIANT 1342 1342 Y -> H (in strain: Isolate CU and Isolate
VA).
VARIANT 1352 1353 DD -> EG (in strain: Isolate VA).
SEQUENCE 1353 AA; 150089 MW; 7B1CE3CBDB1A902A CRC64;
MFLILLISLP TAFAVIGDLK CTSDNINDKD TGPPPISTDT VDVTNGLGTY YVLDRVYLNT
TLFLNGYYPT SGSTYRNMAL KGSVLLSRLW FKPPFLSDFI NGIFAKVKNT KVIKDRVMYS
EFPAITIGST FVNTSYSVVV QPRTINSTQD GDNKLQGLLE VSVCQYNMCE YPQTICHPNL
GNHRKELWHL DTGVVSCLYK RNFTYDVNAD YLYFHFYQEG GTFYAYFTDT GVVTKFLFNV
YLGMALSHYY VMPLTCNSKL TLEYWVTPLT SRQYLLAFNQ DGIIFNAEDC MSDFMSEIKC
KTQSIAPPTG VYELNGYTVQ PIADVYRRKP NLPNCNIEAW LNDKSVPSPL NWERKTFSNC
NFNMSSLMSF IQADSFTCNN IDAAKIYGMC FSSITIDKFA IPNGRKVDLQ LGNLGYLQSF
NYRIDTTATS CQLYYNLPAA NVSVSRFNPS TWNKRFGFIE DSVFKPRPAG VLTNHDVVYA
QHCFKAPKNF CPCKLNGSCV GSGPGKNNGI GTCPAGTNYL TCDNLCTPDP ITFTGTYKCP
QTKSLVGIGE HCSGLAVKSD YCGGNSCTCR PQAFLGWSAD SCLQGDKCNI FANFILHDVN
SGLTCSTDLQ KANTDIILGV CVNYDLYGIL GQGIFVEVNA TYYNSWQNLL YDSNGNLYGF
RDYIINRTFM IRSCYSGRVS AAFHANSSEP ALLFRNIKCN YVFNNSLTRQ LQPINYFDSY
LGCVVNAYNS TAISVQTCDL TVGSGYCVDY SKNRRSRGAI TTGYRFTNFE PFTVNSVNDS
LEPVGGLYEI QIPSEFTIGN MVEFIQTSSP KVTIDCAAFV CGDYAACKSQ LVEYGSFCDN
INAILTEVNE LLDTTQLQVA NSLMNGVTLS TKLKDGVNFN VDDINFSPVL GCLGSECSKA
SSRSAIEDLL FDKVKLSDVG FVEAYNNCTG GAEIRDLICV QSYKGIKVLP PLLSENQISG
YTLAATSASL FPPWTAAAGV PFYLNVQYRI NGLGVTMDVL SQNQKLIANA FNNALYAIQE
GFDATNSALV KIQAVVNANA EALNNLLQQL SNRFGAISAS LQEILSRLDA LEAEAQIDRL
INGRLTALNA YVSQQLSDST LVKFSAAQAM EKVNECVKSQ SSRINFCGNG NHIISLVQNA
PYGLYFIHFS YVPTKYVTAR VSPGLCIAGD RGIAPKSGYF VNVNNTWMYT GSGYYYPEPI
TENNVVVMST CAVNYTKAPY VMLNTSIPNL PDFKEELDQW FKNQTSVAPD LSLDYINVTF
LDLQVEMNRL QEAIKVLNQS YINLKDIGTY EYYVKWPWYV WLLICLAGVA MLVLLFFICC
CTGCGTSCFK KCGGCCDDYT GYQELVIKTS HDD


Related products :

Catalog number Product name Quantity
20-663-48070 SARS Spike protein - Mouse Anti SARS Spike protein; S glycoprotein; Peplomer protein; E2 Monoclonal 0.1 mg
20-663-48070 SARS Spike protein - Mouse Anti SARS Spike protein; S glycoprotein; Peplomer protein; E2 Monoclonal 0.2 mg
10-271-82347 SARS-Associated Coronavirus Spike mosaic S(M) - S glycoprotein; Peplomer protein; E2 1 mg
10-271-82346 SARS-Associated Coronavirus Spike mosaic S(C) - S glycoprotein; Peplomer protein; E2 1 mg
orb81530 SARS Associated Spike Mosaic S(M) protein The E.coli derived 38 kDa recombinant mosaic protein contains the middle section of the Spike protein 408-470, 540-573 amino acids immunodominant regions. For 100
orb81529 SARS Associated Spike Mosaic S(N) protein The E.coli derived 38 kDa mosaic protein contains the N-terminal section of the Spike protein 12-53, 90-115, 171-203 amino acids immunodominant regions. For r 100
SCH-OBT1901 RECOMBINANT SARS SPIKE PROTEIN, Product Type Recombinant Protein, Specificity SARS SPIKE PROTEIN, Target Species Viral, Host N_A, Format Rec. Protein, Isotypes , Applications E, Clone 0.1 mg
OBT1901X RECOMBINANT SARS SPIKE PROTEIN, Product Type Recombinant Protein, Specificity SARS SPIKE PROTEIN, Target Species Viral, Host N_A, Format Rec. Protein, Isotypes , Applications E, WB, Clone 1 mg
SCH-OBT1901X RECOMBINANT SARS SPIKE PROTEIN, Product Type Recombinant Protein, Specificity SARS SPIKE PROTEIN, Target Species Viral, Host N_A, Format Rec. Protein, Isotypes , Applications E, WB, Clone 1 mg
OBT1901 RECOMBINANT SARS SPIKE PROTEIN, Product Type Recombinant Protein, Specificity SARS SPIKE PROTEIN, Target Species Viral, Host N_A, Format Rec. Protein, Isotypes , Applications E, Clone 0.1 mg
18-663-49005 SARS Spike Protein - Rabbit Anti SARS Spike Protein Polyclonal 0.1 mg
18-663-49005 SARS Spike Protein - Rabbit Anti SARS Spike Protein Polyclonal 0.2 mg
RANT-157C SARS Spike Polyclonal Rabbit Anti SARS Spike Protein 300µg
RANT-157B SARS Spike Polyclonal Rabbit Anti SARS Spike Protein 200µg
RANT-157A SARS Spike Polyclonal Rabbit Anti SARS Spike Protein 100µg
orb82497 SARS-CoV, Spike (N-term) recombinant protein SARS-Associated Coronavirus (SARS-CoV) Spike protein (N-terminal) Recombinant is an infectious disease antigen_toxin. For research use only. 1 mg
orb82489 SARS-CoV, Spike (C-term) recombinant protein SARS-Associated Coronavirus (SARS-CoV) Spike protein (C-terminal) Recombinant is an infectious disease antigen_toxin. For research use only. 1 mg
OBT1902X RECOMBINANT SARS SPIKE MOSAIC S(M) (aa408_470 540_573), Product Type Recombinant Protein, Specificity SARS SPIKE MOSAIC, Target Species Viral, Host N_A, Format Rec. Protein, Isotypes , Applicati 1 mg
SCH-OBT1902X RECOMBINANT SARS SPIKE MOSAIC S(M) (aa408_470 540_573), Product Type Recombinant Protein, Specificity SARS SPIKE MOSAIC, Target Species Viral, Host N_A, Format Rec. Protein, Isotypes , Applicati 1 mg
SCH-OBT1903X RECOMBINANT SARS SPIKE MOSAIC S(C) (aa1051_1076 1121_1154 1162_1190), Product Type Recombinant Protein, Specificity SARS SPIKE MOSAIC, Target Species Viral, Host N_A, Format Rec. Protein, Isotype 1 mg
OBT1903X RECOMBINANT SARS SPIKE MOSAIC S(C) (aa1051_1076 1121_1154 1162_1190), Product Type Recombinant Protein, Specificity SARS SPIKE MOSAIC, Target Species Viral, Host N_A, Format Rec. Protein, Isotype 1 mg
ant-157 Polyclonal Rabbit Anti SARS Spike Protein SARS Spike 100
ant-157 Polyclonal Rabbit Anti SARS Spike Protein SARS Spike 200
ant-157 Polyclonal Rabbit Anti SARS Spike Protein SARS Spike 300
SCH-AHP889 RABBIT ANTI SARS SPIKE PROTEIN (N_TERMINAL), Product Type Polyclonal Antibody, Specificity SARS SPIKE PROTEIN , Target Species Viral, Host Rabbit, Format Purified, Isotypes Polyclonal IgG, Appli 0.1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur