Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Steroid hormone receptor ERR2 (ERR beta-2) (Estrogen receptor-like 2) (Estrogen-related receptor beta) (ERR-beta) (Nuclear receptor subfamily 3 group B member 2)

 ERR2_HUMAN              Reviewed;         433 AA.
O95718; A2VDJ2; B6ZGU4; Q5F0P7; Q5F0P8; Q9HCB4;
21-FEB-2001, integrated into UniProtKB/Swiss-Prot.
07-JUN-2017, sequence version 3.
22-NOV-2017, entry version 176.
RecName: Full=Steroid hormone receptor ERR2 {ECO:0000305};
AltName: Full=ERR beta-2;
AltName: Full=Estrogen receptor-like 2;
AltName: Full=Estrogen-related receptor beta {ECO:0000303|PubMed:16332939};
Short=ERR-beta;
AltName: Full=Nuclear receptor subfamily 3 group B member 2;
Name=ESRRB {ECO:0000312|HGNC:HGNC:3473}; Synonyms=ERRB2, ESRL2, NR3B2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Testis;
PubMed=10072763; DOI=10.1016/S0378-1119(98)00619-2;
Chen F., Zhang Q., McDonald T., Davidoff M.J., Bailey W., Bai C.,
Liu Q., Caskey C.T.;
"Identification of two hERR2-related novel nuclear receptors utilizing
bioinformatics and inverse PCR.";
Gene 228:101-109(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), AND ALTERNATIVE
SPLICING.
TISSUE=Heart, and Testis;
PubMed=16332939; DOI=10.1210/jc.2004-1957;
Zhou W., Liu Z., Wu J., Liu J.H., Hyder S.M., Antoniou E.,
Lubahn D.B.;
"Identification and characterization of two novel splicing isoforms of
human estrogen-related receptor beta.";
J. Clin. Endocrinol. Metab. 91:569-579(2006).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
Kobayashi T., Kodani Y., Sawasaki T., Endo Y.;
"Comprehensive DNA-binding analysis of human hormone nuclear receptors
by fluorescence correlation spectroscopy based on cell-free system.";
Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Testis;
Kaighin V.A., Martin A.L., Aronstam R.S.;
"Isolation of cDNA coding for multiple human nuclear receptor
clones.";
Submitted (DEC-2010) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12508121; DOI=10.1038/nature01348;
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S.,
Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C.,
Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P.,
Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N.,
Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C.,
Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S.,
Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B.,
Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M.,
Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S.,
Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D.,
Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A.,
Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L.,
Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J.,
Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W.,
Quetier F., Waterston R., Hood L., Weissenbach J.;
"The DNA sequence and analysis of human chromosome 14.";
Nature 421:601-607(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION (ISOFORM 3), AND INTERACTION WITH NFE2L2.
PubMed=17920186; DOI=10.1016/j.mce.2007.08.011;
Zhou W., Lo S.C., Liu J.H., Hannink M., Lubahn D.B.;
"ERRbeta: a potent inhibitor of Nrf2 transcriptional activity.";
Mol. Cell. Endocrinol. 278:52-62(2007).
[8]
FUNCTION, ALTERNATIVE SPLICING, AND INTERACTION WITH ESR1.
PubMed=19755138; DOI=10.1016/j.mce.2009.09.007;
Bombail V., Collins F., Brown P., Saunders P.T.;
"Modulation of ER alpha transcriptional activity by the orphan nuclear
receptor ERR beta and evidence for differential effects of long- and
short-form splice variants.";
Mol. Cell. Endocrinol. 314:53-61(2010).
[9]
FUNCTION.
PubMed=23836911; DOI=10.1074/jbc.M113.489674;
Cho Y., Hazen B.C., Russell A.P., Kralli A.;
"Peroxisome proliferator-activated receptor gamma coactivator 1 (PGC-
1)- and estrogen-related receptor (ERR)-induced regulator in muscle 1
(Perm1) is a tissue-specific regulator of oxidative capacity in
skeletal muscle cells.";
J. Biol. Chem. 288:25207-25218(2013).
[10]
SUBCELLULAR LOCATION.
PubMed=18775884; DOI=10.1093/humrep/den298;
Bombail V., MacPherson S., Critchley H.O., Saunders P.T.;
"Estrogen receptor related beta is expressed in human endometrium
throughout the normal menstrual cycle.";
Hum. Reprod. 23:2782-2790(2008).
[11]
ACETYLATION BY PCAF/KAT2B.
PubMed=20484414; DOI=10.1210/me.2009-0441;
Wilson B.J., Tremblay A.M., Deblois G., Sylvain-Drolet G., Giguere V.;
"An acetylation switch modulates the transcriptional activity of
estrogen-related receptor alpha.";
Mol. Endocrinol. 24:1349-1358(2010).
[12]
STRUCTURE BY NMR OF 97-194, SUBUNIT, DNA-BINDING, AND MUTAGENESIS OF
TYR-185.
PubMed=12654265; DOI=10.1016/S0022-2836(03)00183-9;
Gearhart M.D., Holmbeck S.M., Evans R.M., Dyson H.J., Wright P.E.;
"Monomeric complex of human orphan estrogen related receptor-2 with
DNA: a pseudo-dimer interface mediates extended half-site
recognition.";
J. Mol. Biol. 327:819-832(2003).
[13]
VARIANTS DFNB35 VAL-110; PRO-320; LEU-342; PRO-347 AND MET-389, AND
VARIANT SER-386.
PubMed=18179891; DOI=10.1016/j.ajhg.2007.09.008;
Collin R.W.J., Kalay E., Tariq M., Peters T., van der Zwaag B.,
Venselaar H., Oostrik J., Lee K., Ahmed Z.M., Caylan R., Li Y.,
Spierenburg H.A., Eyupoglu E., Heister A., Riazuddin S., Bahat E.,
Ansar M., Arslan S., Wollnik B., Brunner H.G., Cremers C.W.R.J.,
Karaguzel A., Ahmad W., Cremers F.P.M., Vriend G., Friedman T.B.,
Riazuddin S., Leal S.M., Kremer H.;
"Mutations of ESRRB encoding estrogen-related receptor beta cause
autosomal-recessive nonsyndromic hearing impairment DFNB35.";
Am. J. Hum. Genet. 82:125-138(2008).
-!- FUNCTION: Isoform 3: Transcription factor that binds a canonical
ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on
promoter and enhancer of targets genes regulating their expression
or their transcription activity (PubMed:17920186,
PubMed:19755138). Plays a role, in a LIF-independent manner, in
maintainance of self-renewal and pluripotency of embryonic and
trophoblast stem cells through different signaling pathways
including FGF signaling pathway and Wnt signaling pathways. Upon
FGF signaling pathway activation, interacts with KDM1A by directly
binding to enhancer site of ELF5 and EOMES and activating their
transcription leading to self-renewal of trophoblast stem cells.
Also regulates expression of multiple rod-specific genes and is
required for survival of this cell type (By similarity). Plays a
role as transcription factor activator of GATA6, NR0B1, POU5F1 and
PERM1 (PubMed:23836911). Plays a role as transcription factor
repressor of NFE2L2 transcriptional activity and ESR1
transcriptional activity (PubMed:17920186, PubMed:19755138).
During mitosis remains bound to a subset of interphase target
genes, including pluripotency regulators, through the canonical
ESRRB recognition (ERRE) sequence, leading to their
transcriptional activation in early G1 phase. Can coassemble on
structured DNA elements with other transcription factors like
SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene
activation. This mechanism, in the case of SOX2 corecruitment
prevents the embryonic stem cells (ESCs) to epiblast stem cells
(EpiSC) transition through positive regulation of NR0B1 that
inhibits the EpiSC transcriptional program. Also plays a role
inner ear development by controlling expression of ion channels
and transporters and in early placentation (By similarity).
{ECO:0000250|UniProtKB:Q61539, ECO:0000269|PubMed:17920186,
ECO:0000269|PubMed:19755138, ECO:0000269|PubMed:23836911}.
-!- FUNCTION: Isoform 1: Transcription factor that binds a canonical
ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on
promoter and enhancer of targets genes regulating their expression
or their transcription activity. Positively regaulate ESR1
transcriptional activity upon E2 stimulation.
{ECO:0000269|PubMed:19755138}.
-!- SUBUNIT: Binds DNA as a monomer (PubMed:12654265). Interacts with
NR0B1; represses ESRRB activity at the GATA6 promoter. Interacts
with NANOG; reciprocally modulates their transcriptional
activities and activates POU5F1 expression. Interacts with NCOA3;
mediates the interaction between ESRRB and RNA polymerase II
complexes and allows NCOA3 corecruitment to ESRRB, KLF4, NANOG,
and SOX2 enhancer regions to trigger ESRRB-dependent gene
activation involved in self-renewal and pluripotency. Interacts
with KDM1A; co-occupes the core set of ESRRB targets including
ELF5 and EOMES. Interacts with the multiprotein complex
Integrator, at least composed of INTS1, INTS2, INTS3, INTS4,
INTS5, INTS6, INTS7, INTS8, INTS9/RC74, INTS10, INTS11/CPSF3L and
INTS12; ESRRB is probably not a core component of the integrator
complex and associates to integrator via its interaction with
INTS1 and INTS9; attracts the transcriptional machinery. Interacts
with JARID2. Interacts with POU5F1; recruits ESRRB near the
POU5F1-SOX2 element in the NANOG proximal promoter leading to
activation of NANOG expression; the intercaction is DNA
independent (By similarity). Interacts with NFE2L2; represses
NFE2L2 transcriptional activity (PubMed:17920186). Isoform 1
interacts with ESR1 (PubMed:19755138).
{ECO:0000250|UniProtKB:Q61539, ECO:0000269|PubMed:12654265,
ECO:0000269|PubMed:17920186, ECO:0000269|PubMed:19755138}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:18775884}.
Cytoplasm {ECO:0000250|UniProtKB:Q61539}. Chromosome
{ECO:0000250|UniProtKB:Q61539}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=3; Synonyms=ERRbeta-short-form {ECO:0000303|PubMed:16332939};
IsoId=O95718-3; Sequence=Displayed;
Name=1; Synonyms=ERRbeta2-delta10 {ECO:0000303|PubMed:16332939};
IsoId=O95718-1; Sequence=VSP_058967;
Note=Primate-specific splicing isoform.
{ECO:0000303|PubMed:16332939};
Name=2; Synonyms=ERRbeta2 {ECO:0000303|PubMed:16332939};
IsoId=O95718-2; Sequence=VSP_058968;
Note=Primate-specific splicing isoform.
{ECO:0000303|PubMed:16332939};
-!- PTM: Acetylated by PCAF/KAT2 (in vitro).
{ECO:0000269|PubMed:20484414}.
-!- DISEASE: Deafness, autosomal recessive, 35 (DFNB35) [MIM:608565]:
A form of non-syndromic deafness characterized by non-progressive,
prelingual hearing loss. {ECO:0000269|PubMed:18179891}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- SIMILARITY: Belongs to the nuclear hormone receptor family. NR3
subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF094517; AAC99409.1; -; mRNA.
EMBL; AY451389; AAS15571.1; -; mRNA.
EMBL; AY451390; AAS15572.1; -; mRNA.
EMBL; AB307714; BAH02305.1; -; mRNA.
EMBL; HQ692852; ADZ17363.1; -; mRNA.
EMBL; AC008050; AAG17472.1; -; Genomic_DNA.
EMBL; AC016543; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC131517; AAI31518.1; -; mRNA.
CCDS; CCDS9850.2; -. [O95718-1]
RefSeq; NP_004443.3; NM_004452.3. [O95718-1]
RefSeq; XP_016876575.1; XM_017021086.1. [O95718-1]
UniGene; Hs.435845; -.
PDB; 1LO1; NMR; -; A=97-192.
PDBsum; 1LO1; -.
ProteinModelPortal; O95718; -.
SMR; O95718; -.
BioGrid; 108406; 92.
IntAct; O95718; 1.
STRING; 9606.ENSP00000370270; -.
BindingDB; O95718; -.
ChEMBL; CHEMBL3751; -.
GuidetoPHARMACOLOGY; 623; -.
iPTMnet; O95718; -.
PhosphoSitePlus; O95718; -.
BioMuta; ESRRB; -.
PaxDb; O95718; -.
PeptideAtlas; O95718; -.
PRIDE; O95718; -.
DNASU; 2103; -.
Ensembl; ENST00000380887; ENSP00000370270; ENSG00000119715. [O95718-1]
Ensembl; ENST00000505752; ENSP00000423004; ENSG00000119715. [O95718-2]
Ensembl; ENST00000509242; ENSP00000422488; ENSG00000119715. [O95718-1]
Ensembl; ENST00000556177; ENSP00000451658; ENSG00000119715. [O95718-3]
GeneID; 2103; -.
KEGG; hsa:2103; -.
UCSC; uc001xsq.2; human. [O95718-3]
CTD; 2103; -.
DisGeNET; 2103; -.
EuPathDB; HostDB:ENSG00000119715.14; -.
GeneCards; ESRRB; -.
GeneReviews; ESRRB; -.
HGNC; HGNC:3473; ESRRB.
MalaCards; ESRRB; -.
MIM; 602167; gene.
MIM; 608565; phenotype.
neXtProt; NX_O95718; -.
OpenTargets; ENSG00000119715; -.
Orphanet; 90636; Autosomal recessive non-syndromic sensorineural deafness type DFNB.
PharmGKB; PA27889; -.
eggNOG; KOG3575; Eukaryota.
eggNOG; ENOG410XRZC; LUCA.
GeneTree; ENSGT00760000118887; -.
HOGENOM; HOG000233467; -.
HOVERGEN; HBG108344; -.
InParanoid; O95718; -.
KO; K08553; -.
OMA; LPFNGKL; -.
OrthoDB; EOG091G0DYP; -.
TreeFam; TF323751; -.
Reactome; R-HSA-383280; Nuclear Receptor transcription pathway.
SignaLink; O95718; -.
SIGNOR; O95718; -.
ChiTaRS; ESRRB; human.
EvolutionaryTrace; O95718; -.
GeneWiki; Estrogen-related_receptor_beta; -.
GenomeRNAi; 2103; -.
PRO; PR:O95718; -.
Proteomes; UP000005640; Chromosome 14.
Bgee; ENSG00000119715; -.
CleanEx; HS_ESRRB; -.
ExpressionAtlas; O95718; baseline and differential.
Genevisible; O95718; HS.
GO; GO:0000793; C:condensed chromosome; ISS:UniProtKB.
GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; ISS:BHF-UCL.
GO; GO:0001047; F:core promoter binding; ISS:UniProtKB.
GO; GO:0035326; F:enhancer binding; ISS:UniProtKB.
GO; GO:0001158; F:enhancer sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0004879; F:nuclear receptor activity; TAS:ProtInc.
GO; GO:0000993; F:RNA polymerase II core binding; ISS:UniProtKB.
GO; GO:0000980; F:RNA polymerase II distal enhancer sequence-specific DNA binding; ISS:BHF-UCL.
GO; GO:0043565; F:sequence-specific DNA binding; IDA:UniProtKB.
GO; GO:0005496; F:steroid binding; IEA:InterPro.
GO; GO:0003707; F:steroid hormone receptor activity; IEA:InterPro.
GO; GO:0003713; F:transcription coactivator activity; ISS:BHF-UCL.
GO; GO:0003705; F:transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding; ISS:UniProtKB.
GO; GO:0003700; F:transcription factor activity, sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0008134; F:transcription factor binding; ISS:BHF-UCL.
GO; GO:0001205; F:transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding; ISS:UniProtKB.
GO; GO:0001191; F:transcriptional repressor activity, RNA polymerase II transcription factor binding; IDA:UniProtKB.
GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
GO; GO:0043697; P:cell dedifferentiation; ISS:UniProtKB.
GO; GO:0008283; P:cell proliferation; IDA:UniProtKB.
GO; GO:0048839; P:inner ear development; ISS:UniProtKB.
GO; GO:2000737; P:negative regulation of stem cell differentiation; ISS:UniProtKB.
GO; GO:0045494; P:photoreceptor cell maintenance; ISS:UniProtKB.
GO; GO:0045725; P:positive regulation of glycogen biosynthetic process; IEA:Ensembl.
GO; GO:0045821; P:positive regulation of glycolytic process; IEA:Ensembl.
GO; GO:1902459; P:positive regulation of stem cell population maintenance; ISS:UniProtKB.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; ISS:BHF-UCL.
GO; GO:0071931; P:positive regulation of transcription involved in G1/S transition of mitotic cell cycle; ISS:UniProtKB.
GO; GO:0090282; P:positive regulation of transcription involved in G2/M transition of mitotic cell cycle; ISS:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; ISS:UniProtKB.
GO; GO:2000035; P:regulation of stem cell division; ISS:UniProtKB.
GO; GO:0006355; P:regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0017145; P:stem cell division; ISS:UniProtKB.
GO; GO:0019827; P:stem cell population maintenance; IDA:UniProtKB.
GO; GO:0006367; P:transcription initiation from RNA polymerase II promoter; TAS:Reactome.
Gene3D; 1.10.565.10; -; 1.
Gene3D; 3.30.50.10; -; 1.
InterPro; IPR035500; NHR_like_dom_sf.
InterPro; IPR000536; Nucl_hrmn_rcpt_lig-bd.
InterPro; IPR001723; Nuclear_hrmn_rcpt.
InterPro; IPR027289; Oest-rel_rcp.
InterPro; IPR024178; Oest_rcpt/oest-rel_rcp.
InterPro; IPR001628; Znf_hrmn_rcpt.
InterPro; IPR013088; Znf_NHR/GATA.
Pfam; PF00104; Hormone_recep; 1.
Pfam; PF00105; zf-C4; 1.
PIRSF; PIRSF002527; ER-like_NR; 1.
PIRSF; PIRSF500939; ERR1-2-3; 1.
PRINTS; PR00398; STRDHORMONER.
PRINTS; PR00047; STROIDFINGER.
SMART; SM00430; HOLI; 1.
SMART; SM00399; ZnF_C4; 1.
SUPFAM; SSF48508; SSF48508; 1.
PROSITE; PS00031; NUCLEAR_REC_DBD_1; 1.
PROSITE; PS51030; NUCLEAR_REC_DBD_2; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Chromosome;
Complete proteome; Cytoplasm; Deafness; Disease mutation; DNA-binding;
Metal-binding; Non-syndromic deafness; Nucleus; Receptor;
Reference proteome; Transcription; Transcription regulation; Zinc;
Zinc-finger.
CHAIN 1 433 Steroid hormone receptor ERR2.
/FTId=PRO_0000053662.
DNA_BIND 100 186 Nuclear receptor. {ECO:0000255|PROSITE-
ProRule:PRU00407}.
ZN_FING 103 123 NR C4-type. {ECO:0000255|PROSITE-
ProRule:PRU00407}.
ZN_FING 139 163 NR C4-type. {ECO:0000255|PROSITE-
ProRule:PRU00407}.
REGION 93 211 Interaction with NANOG.
{ECO:0000250|UniProtKB:Q61539}.
REGION 203 433 Essential for ESRRB transcriptional
activity and interaction with NCOA3.
{ECO:0000250|UniProtKB:Q61539}.
SITE 185 185 Important for stabilizing DNA-binding.
VAR_SEQ 433 433 V -> VGQEQLRGSPKDERMSSHDGKCPFQSAAFTSRDQSN
SPGIPNPRPSSPTPLNERGRQISPSTRTPGGQGKHLWLTM
(in isoform 1).
/FTId=VSP_058967.
VAR_SEQ 433 433 V -> AWARADSLQEWRPLEQVPSPLHRATKRQHVHFLTPL
PPPPSVAWVGTAQAGYHLEVFLPQRAGWPRAA (in
isoform 2).
/FTId=VSP_058968.
VARIANT 110 110 A -> V (in DFNB35; dbSNP:rs121909110).
{ECO:0000269|PubMed:18179891}.
/FTId=VAR_043503.
VARIANT 320 320 L -> P (in DFNB35).
{ECO:0000269|PubMed:18179891}.
/FTId=VAR_043504.
VARIANT 342 342 V -> L (in DFNB35; dbSNP:rs121909111).
{ECO:0000269|PubMed:18179891}.
/FTId=VAR_043505.
VARIANT 347 347 L -> P (in DFNB35).
{ECO:0000269|PubMed:18179891}.
/FTId=VAR_043506.
VARIANT 386 386 P -> S (in dbSNP:rs61742642).
{ECO:0000269|PubMed:18179891}.
/FTId=VAR_043507.
VARIANT 389 389 T -> M (in DFNB35; uncertain pathological
significance; dbSNP:rs201714970).
{ECO:0000269|PubMed:18179891}.
/FTId=VAR_043508.
MUTAGEN 185 185 Y->A: 6-fold decrease in DNA-binding
affinity. {ECO:0000269|PubMed:12654265}.
CONFLICT 248 248 D -> E (in Ref. 3; BAH02305).
{ECO:0000305}.
CONFLICT 429 429 L -> V (in Ref. 6; AAI31518).
{ECO:0000305}.
TURN 104 107 {ECO:0000244|PDB:1LO1}.
STRAND 111 119 {ECO:0000244|PDB:1LO1}.
HELIX 121 132 {ECO:0000244|PDB:1LO1}.
HELIX 149 154 {ECO:0000244|PDB:1LO1}.
HELIX 156 166 {ECO:0000244|PDB:1LO1}.
HELIX 170 172 {ECO:0000244|PDB:1LO1}.
SEQUENCE 433 AA; 48054 MW; ED1D3F87E2798DD1 CRC64;
MSSDDRHLGS SCGSFIKTEP SSPSSGIDAL SHHSPSGSSD ASGGFGLALG THANGLDSPP
MFAGAGLGGT PCRKSYEDCA SGIMEDSAIK CEYMLNAIPK RLCLVCGDIA SGYHYGVASC
EACKAFFKRT IQGNIEYSCP ATNECEITKR RRKSCQACRF MKCLKVGMLK EGVRLDRVRG
GRQKYKRRLD SESSPYLSLQ ISPPAKKPLT KIVSYLLVAE PDKLYAMPPP GMPEGDIKAL
TTLCDLADRE LVVIIGWAKH IPGFSSLSLG DQMSLLQSAW MEILILGIVY RSLPYDDKLV
YAEDYIMDEE HSRLAGLLEL YRAILQLVRR YKKLKVEKEE FVTLKALALA NSDSMYIEDL
EAVQKLQDLL HEALQDYELS QRHEEPWRTG KLLLTLPLLR QTAAKAVQHF YSVKLQGKVP
MHKLFLEMLE AKV


Related products :

Catalog number Product name Quantity
EIAAB13286 Err2,ERR-beta,Esrl2,Esrrb,Estrogen receptor-like 2,Estrogen-related receptor beta,Nr3b2,Nuclear receptor subfamily 3 group B member 2,Rat,Rattus norvegicus,Steroid hormone receptor ERR2
EIAAB13285 Err2,Err-2,ERR-beta,Esrrb,Estrogen receptor-like 2,Estrogen-related receptor beta,Mouse,Mus musculus,Nr3b2,Nuclear receptor subfamily 3 group B member 2,Steroid hormone receptor ERR2
EIAAB13284 ERR beta-2,ERRB2,ERR-beta,ESRL2,ESRRB,Estrogen receptor-like 2,Estrogen-related receptor beta,Homo sapiens,Human,NR3B2,Nuclear receptor subfamily 3 group B member 2,Steroid hormone receptor ERR2
18-461-10248 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 ml
18-461-10249 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 ml
18-003-42074 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 mg Aff Pur
18-461-10247 Steroid hormone receptor ERR2 - Estrogen-related receptor. beta; ERR-beta; Estrogen receptor-like 2; ERR beta-2 Polyclonal 0.05 ml
EIAAB13281 Err1,ERR-alpha,Esrra,Estrogen receptor-like 1,Estrogen-related receptor alpha,Estrra,Mouse,Mus musculus,Nr3b1,Nuclear receptor subfamily 3 group B member 1,Steroid hormone receptor ERR1
EIAAB13282 ERR1,ERR-alpha,ESRL1,ESRRA,Estrogen receptor-like 1,Estrogen-related receptor alpha,Homo sapiens,Human,NR3B1,Nuclear receptor subfamily 3 group B member 1,Steroid hormone receptor ERR1
EIAAB13280 ERR-alpha,Esrra,Estrogen-related receptor alpha,Nr3b1,Nuclear receptor subfamily 3 group B member 1,Rat,Rattus norvegicus,Steroid hormone receptor ERR1
EIAAB35715 Homo sapiens,Human,NR1F2,Nuclear receptor ROR-beta,Nuclear receptor RZR-beta,Nuclear receptor subfamily 1 group F member 2,Retinoid-related orphan receptor-beta,RORB,RZRB
EIAAB35716 Nr1f2,Nuclear receptor ROR-beta,Nuclear receptor RZR-beta,Nuclear receptor subfamily 1 group F member 2,Rat,Rattus norvegicus,Retinoid-related orphan receptor-beta,Rorb,Rzrb
EIAAB35714 Mouse,Mus musculus,Nr1f2,Nuclear receptor ROR-beta,Nuclear receptor RZR-beta,Nuclear receptor subfamily 1 group F member 2,Retinoid-related orphan receptor-beta,Rorb
E2300p ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa
E2300b Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2
E2300p ELISA ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
E2300p ELISA kit ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
U2300p CLIA kit ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
U2300p CLIA ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2,Pig,Sus scrofa 96T
E2300r Erbeta,ER-beta,Esr2,Estrogen receptor beta,Nr3a2,Nuclear receptor subfamily 3 group A member 2,Rat,Rattus norvegicus
U2300b CLIA kit Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
E2300m ER-beta,Esr2,Estrb,Estrogen receptor beta,Mouse,Mus musculus,Nr3a2,Nuclear receptor subfamily 3 group A member 2
E2300b ELISA Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
U2300b CLIA Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T
E2300b ELISA kit Bos taurus,Bovine,ER-beta,ESR2,Estrogen receptor beta,NR3A2,Nuclear receptor subfamily 3 group A member 2 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur