Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Steroidogenic acute regulatory protein, mitochondrial (StAR) (START domain-containing protein 1) (StARD1)

 STAR_RAT                Reviewed;         284 AA.
P97826; P97628;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
01-MAY-1997, sequence version 1.
30-AUG-2017, entry version 120.
RecName: Full=Steroidogenic acute regulatory protein, mitochondrial;
Short=StAR;
AltName: Full=START domain-containing protein 1;
Short=StARD1;
Flags: Precursor;
Name=Star;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=Wistar; TISSUE=Ovary;
PubMed=9328229; DOI=10.1016/S0024-3205(97)00709-1;
Mizutani T., Sonoda Y., Minegishi T., Wakabayashi K., Miyamoto K.;
"Molecular cloning, characterization and cellular distribution of rat
steroidogenic acute regulatory protein (StAR) in the ovary.";
Life Sci. 61:1497-1506(1997).
[2]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=Sprague-Dawley; TISSUE=Testis;
PubMed=9015355; DOI=10.1006/bbrc.1996.6001;
Lee H.K., Ahn R.S., Kwon H.B., Soh J.;
"Nucleotide sequence of rat steroidogenic acute regulatory protein
complementary DNA.";
Biochem. Biophys. Res. Commun. 230:528-532(1997).
[3]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=Sprague-Dawley; TISSUE=Adrenal gland;
PubMed=9516465; DOI=10.1074/jbc.273.13.7610;
Ariyoshi N., Kim Y.-C., Artemenko I., Bhattacharyya K.K.,
Jefcoate C.R.;
"Characterization of the rat Star gene that encodes the predominant
3.5-kilobase pair mRNA. ACTH stimulation of adrenal steroids in vivo
precedes elevation of Star mRNA and protein.";
J. Biol. Chem. 273:7610-7619(1998).
[4]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=Sprague-Dawley; TISSUE=Adrenal gland;
PubMed=9832120;
Furukawa A., Miyatake A., Ohnishi T., Ichikawa Y.;
"Steroidogenic acute regulatory protein (StAR) transcripts
constitutively expressed in the adult rat central nervous system:
colocalization of StAR, cytochrome P-450scc (CYPXIA1), and 3beta-
hydroxysteroid dehydrogenase in the rat brain.";
J. Neurochem. 71:2231-2238(1998).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
TISSUE=Ovary;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
PHOSPHORYLATION.
PubMed=7626524; DOI=10.1016/0960-0760(95)00026-V;
Hartigan J.A., Green E.G., Mortensen R.M., Menachery A.,
Williams G.H., Orme-Johnson N.R.;
"Comparison of protein phosphorylation patterns produced in adrenal
cells by activation of cAMP-dependent protein kinase and Ca-dependent
protein kinase.";
J. Steroid Biochem. Mol. Biol. 53:95-101(1995).
-!- FUNCTION: Plays a key role in steroid hormone synthesis by
enhancing the metabolism of cholesterol into pregnenolone.
Mediates the transfer of cholesterol from the outer mitochondrial
membrane to the inner mitochondrial membrane where it is cleaved
to pregnenolone (By similarity). {ECO:0000250}.
-!- PATHWAY: Steroid metabolism; cholesterol metabolism.
-!- SUBUNIT: May interact with TSPO. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Mitochondrion.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB001349; BAA19245.1; -; mRNA.
EMBL; U76419; AAB41674.1; -; mRNA.
EMBL; AF044081; AAC02528.1; -; mRNA.
EMBL; AB006007; BAA34737.1; -; mRNA.
EMBL; BC088859; AAH88859.1; -; mRNA.
RefSeq; NP_113746.1; NM_031558.3.
UniGene; Rn.11399; -.
ProteinModelPortal; P97826; -.
SMR; P97826; -.
BioGrid; 247588; 1.
STRING; 10116.ENSRNOP00000020606; -.
iPTMnet; P97826; -.
PhosphoSitePlus; P97826; -.
PaxDb; P97826; -.
PRIDE; P97826; -.
Ensembl; ENSRNOT00000020606; ENSRNOP00000020606; ENSRNOG00000015052.
GeneID; 25557; -.
KEGG; rno:25557; -.
UCSC; RGD:3770; rat.
CTD; 6770; -.
RGD; 3770; Star.
eggNOG; KOG3845; Eukaryota.
eggNOG; ENOG41100B5; LUCA.
GeneTree; ENSGT00530000063139; -.
HOGENOM; HOG000142452; -.
HOVERGEN; HBG010529; -.
InParanoid; P97826; -.
KO; K16931; -.
OMA; ATFKLCA; -.
OrthoDB; EOG091G06RM; -.
PhylomeDB; P97826; -.
TreeFam; TF313869; -.
Reactome; R-RNO-196108; Pregnenolone biosynthesis.
UniPathway; UPA00296; -.
PRO; PR:P97826; -.
Proteomes; UP000002494; Chromosome 16.
Bgee; ENSRNOG00000015052; -.
Genevisible; P97826; RN.
GO; GO:0005829; C:cytosol; IDA:RGD.
GO; GO:0030061; C:mitochondrial crista; IDA:RGD.
GO; GO:0005758; C:mitochondrial intermembrane space; IDA:RGD.
GO; GO:0043005; C:neuron projection; IDA:RGD.
GO; GO:0043025; C:neuronal cell body; IDA:RGD.
GO; GO:0015485; F:cholesterol binding; IBA:GO_Central.
GO; GO:0017127; F:cholesterol transporter activity; TAS:RGD.
GO; GO:0006699; P:bile acid biosynthetic process; IDA:RGD.
GO; GO:0018879; P:biphenyl metabolic process; IEP:RGD.
GO; GO:0007420; P:brain development; IEP:RGD.
GO; GO:0071312; P:cellular response to alkaloid; IEP:RGD.
GO; GO:0071236; P:cellular response to antibiotic; IEP:RGD.
GO; GO:0071276; P:cellular response to cadmium ion; IEP:RGD.
GO; GO:0071320; P:cellular response to cAMP; IEP:RGD.
GO; GO:0071549; P:cellular response to dexamethasone stimulus; IEP:RGD.
GO; GO:0071872; P:cellular response to epinephrine stimulus; IEP:RGD.
GO; GO:0044344; P:cellular response to fibroblast growth factor stimulus; IEP:RGD.
GO; GO:0071372; P:cellular response to follicle-stimulating hormone stimulus; IEP:RGD.
GO; GO:0071333; P:cellular response to glucose stimulus; IEP:RGD.
GO; GO:0071371; P:cellular response to gonadotropin stimulus; IEP:RGD.
GO; GO:0071378; P:cellular response to growth hormone stimulus; IEP:RGD.
GO; GO:0032869; P:cellular response to insulin stimulus; IEP:RGD.
GO; GO:0035457; P:cellular response to interferon-alpha; IMP:RGD.
GO; GO:0071346; P:cellular response to interferon-gamma; IEP:RGD.
GO; GO:0071222; P:cellular response to lipopolysaccharide; IEP:RGD.
GO; GO:0071373; P:cellular response to luteinizing hormone stimulus; IEP:RGD.
GO; GO:0071248; P:cellular response to metal ion; IEP:RGD.
GO; GO:0071407; P:cellular response to organic cyclic compound; IEP:RGD.
GO; GO:0071560; P:cellular response to transforming growth factor beta stimulus; IEP:RGD.
GO; GO:0008203; P:cholesterol metabolic process; IEA:UniProtKB-UniPathway.
GO; GO:0007623; P:circadian rhythm; IEP:RGD.
GO; GO:0042747; P:circadian sleep/wake cycle, REM sleep; IEP:RGD.
GO; GO:0018894; P:dibenzo-p-dioxin metabolic process; IEP:RGD.
GO; GO:0016101; P:diterpenoid metabolic process; IEP:RGD.
GO; GO:0006703; P:estrogen biosynthetic process; IMP:RGD.
GO; GO:0008211; P:glucocorticoid metabolic process; IEA:Ensembl.
GO; GO:0017143; P:insecticide metabolic process; IEP:RGD.
GO; GO:0032367; P:intracellular cholesterol transport; IEP:RGD.
GO; GO:0008584; P:male gonad development; IEP:RGD.
GO; GO:0043524; P:negative regulation of neuron apoptotic process; IMP:RGD.
GO; GO:0006082; P:organic acid metabolic process; IEP:RGD.
GO; GO:0018958; P:phenol-containing compound metabolic process; IEP:RGD.
GO; GO:0018963; P:phthalate metabolic process; IEP:RGD.
GO; GO:0070859; P:positive regulation of bile acid biosynthetic process; IEA:Ensembl.
GO; GO:0010628; P:positive regulation of gene expression; IMP:RGD.
GO; GO:0050769; P:positive regulation of neurogenesis; IMP:RGD.
GO; GO:0048168; P:regulation of neuronal synaptic plasticity; IMP:RGD.
GO; GO:0014823; P:response to activity; IEP:RGD.
GO; GO:0046677; P:response to antibiotic; IEP:RGD.
GO; GO:0051412; P:response to corticosterone; IEP:RGD.
GO; GO:0042493; P:response to drug; IEP:RGD.
GO; GO:0043627; P:response to estrogen; IEP:RGD.
GO; GO:0045471; P:response to ethanol; IEP:RGD.
GO; GO:0060992; P:response to fungicide; IEP:RGD.
GO; GO:0034698; P:response to gonadotropin; IEP:RGD.
GO; GO:0009635; P:response to herbicide; IEP:RGD.
GO; GO:0042542; P:response to hydrogen peroxide; IEP:RGD.
GO; GO:0017085; P:response to insecticide; IEP:RGD.
GO; GO:0010212; P:response to ionizing radiation; IEP:RGD.
GO; GO:0010288; P:response to lead ion; IEP:RGD.
GO; GO:0044321; P:response to leptin; IEP:RGD.
GO; GO:0035094; P:response to nicotine; IEP:RGD.
GO; GO:0007584; P:response to nutrient; IEP:RGD.
GO; GO:0031667; P:response to nutrient levels; IEP:RGD.
GO; GO:0014070; P:response to organic cyclic compound; IEP:RGD.
GO; GO:0010033; P:response to organic substance; IEP:RGD.
GO; GO:0043434; P:response to peptide hormone; IEP:RGD.
GO; GO:0048545; P:response to steroid hormone; IEP:RGD.
GO; GO:0009636; P:response to toxic substance; IEP:RGD.
GO; GO:0006694; P:steroid biosynthetic process; TAS:RGD.
GO; GO:0061370; P:testosterone biosynthetic process; IEP:RGD.
CDD; cd08905; START_STARD1-like; 1.
Gene3D; 3.30.530.20; -; 1.
InterPro; IPR029866; StAR.
InterPro; IPR000799; StAR-like.
InterPro; IPR023393; START-like_dom.
InterPro; IPR002913; START_lipid-bd_dom.
PANTHER; PTHR12136:SF74; PTHR12136:SF74; 1.
Pfam; PF01852; START; 1.
PRINTS; PR00978; STARPROTEIN.
SMART; SM00234; START; 1.
PROSITE; PS50848; START; 1.
1: Evidence at protein level;
Complete proteome; Lipid transport; Lipid-binding; Mitochondrion;
Phosphoprotein; Reference proteome; Steroidogenesis; Transit peptide;
Transport.
TRANSIT 1 62 Mitochondrion. {ECO:0000250}.
CHAIN 63 284 Steroidogenic acute regulatory protein,
mitochondrial.
/FTId=PRO_0000033320.
DOMAIN 66 279 START. {ECO:0000255|PROSITE-
ProRule:PRU00197}.
MOD_RES 56 56 Phosphoserine; by PKA.
{ECO:0000250|UniProtKB:P49675}.
MOD_RES 194 194 Phosphoserine; by PKA.
{ECO:0000250|UniProtKB:P49675}.
CONFLICT 1 7 MLLATFK -> MIWFSTAVLIGLYVFERFPTSMIGVGLFTN
LVYFGLLQTFPFIMLTSPNFILSCGLVVVNHYLAFQFFAEE
YYPFSEVLAYFTFC (in Ref. 2; AAB41674).
{ECO:0000305}.
SEQUENCE 284 AA; 31501 MW; 439C41B971EE8270 CRC64;
MLLATFKLCA GSSYRHMRNM KGLRHQAVLA IGQELNRRAL GDPSPGWMGQ VRRRSSLLGS
QLEATLYSDQ ELSYIQQGEE AMQKALGILN NQEGWKKESQ QENGDEVLSK VVPGVGKVFR
LEVLLDQPMD RLYEELVDRM EAMGEWNPNV KEIKVLKKIG KDTVITHELA AAAAGNLVGP
RDFVSVRCTK RRGSTCVLAG MATHFGEMPE QSGVIRAEHG PTCMVLHPLA GSPSKTKLTW
LLSIDLKGWL PKTIINQVLS QTQIEFASHL RKRLESSPAS EAQC


Related products :

Catalog number Product name Quantity
EIAAB40226 Homo sapiens,Human,StAR,STAR,StARD1,STARD1,START domain-containing protein 1,Steroidogenic acute regulatory protein, mitochondrial
EIAAB40227 Pig,StAR,STAR,StARD1,START domain-containing protein 1,Steroidogenic acute regulatory protein, mitochondrial,Sus scrofa
EIAAB40222 Bos taurus,Bovine,StAR,STAR,StARD1,START domain-containing protein 1,Steroidogenic acute regulatory protein, mitochondrial
EIAAB40225 Rat,Rattus norvegicus,StAR,Star,StARD1,START domain-containing protein 1,Steroidogenic acute regulatory protein, mitochondrial
EIAAB40223 Luteinizing hormone-induced protein,Mouse,Mus musculus,StAR,Star,StARD1,START domain-containing protein 1,Steroidogenic acute regulatory protein, mitochondrial
EIAAB40224 Chicken,Gallus gallus,StAR,STAR,StARD1,START domain-containing protein 1,Steroidogenic acute regulatory protein, mitochondrial
CSB-EL022798RA Rat Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit 96T
H3272 Steroidogenic acute regulatory protein, mitochondrial (STAR), Rat, ELISA Kit 96T
H3273 Steroidogenic acute regulatory protein, mitochondrial (STAR), Sheep, ELISA Kit 96T
CSB-EL022798HU Human Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit 96T
CSB-EL022798CH Chicken Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit 96T
H3267 Steroidogenic acute regulatory protein, mitochondrial (STAR), Bovine, ELISA Kit 96T
H3268 Steroidogenic acute regulatory protein, mitochondrial (STAR), Chicken, ELISA Kit 96T
H3271 Steroidogenic acute regulatory protein, mitochondrial (STAR), Mouse, ELISA Kit 96T
CSB-EL022798RA Rat Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit SpeciesRat 96T
H3270 Steroidogenic acute regulatory protein, mitochondrial (STAR), Human, ELISA Kit 96T
H3269 Steroidogenic acute regulatory protein, mitochondrial (STAR), Horse, ELISA Kit 96T
CSB-EL022798MO Mouse Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit 96T
CSB-EL022798BO Bovine Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit 96T
CSB-EL022798HU Human Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit SpeciesHuman 96T
CSB-EL022798MO Mouse Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit SpeciesMouse 96T
CSB-EL022798BO Bovine Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit SpeciesBovine 96T
CSB-EL022798SH Sheep Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit SpeciesSheep 96T
STAR_RAT ELISA Kit FOR Steroidogenic acute regulatory protein, mitochondrial; organism: Rat; gene name: Star 96T
CSB-EL022798CH Chicken Steroidogenic acute regulatory protein, mitochondrial(STAR) ELISA kit SpeciesChicken 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur