Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Synaptotagmin-16 (Synaptotagmin 14-like protein) (Synaptotagmin XIV-related protein)

 SYT16_MOUSE             Reviewed;         639 AA.
Q7TN83; Q3UVM4; Q6PGM6; Q8BJ41;
31-OCT-2006, integrated into UniProtKB/Swiss-Prot.
01-OCT-2003, sequence version 1.
30-AUG-2017, entry version 100.
RecName: Full=Synaptotagmin-16;
AltName: Full=Synaptotagmin 14-like protein;
AltName: Full=Synaptotagmin XIV-related protein;
Name=Syt16; Synonyms=Strep14, Syt14l, Syt14r;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBUNIT, TISSUE
SPECIFICITY, AND DEVELOPMENTAL STAGE.
STRAIN=BALB/cJ;
PubMed=12801916; DOI=10.1093/jb/mvg082;
Fukuda M.;
"Molecular cloning, expression, and characterization of a novel class
of synaptotagmin (Syt XIV) conserved from Drosophila to humans.";
J. Biochem. 133:641-649(2003).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
STRAIN=C57BL/6J; TISSUE=Olfactory bulb;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
STRAIN=C57BL/6J; TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: May be involved in the trafficking and exocytosis of
secretory vesicles in non-neuronal tissues. Is Ca(2+)-independent.
{ECO:0000269|PubMed:12801916}.
-!- SUBUNIT: Homodimer. Can also form heterodimers.
{ECO:0000269|PubMed:12801916}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q7TN83-1; Sequence=Displayed;
Name=2;
IsoId=Q7TN83-2; Sequence=VSP_021382, VSP_021384, VSP_021385;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q7TN83-3; Sequence=VSP_021381, VSP_021383;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Highly expressed in heart and testis.
Moderately expressed in kidney. {ECO:0000269|PubMed:12801916}.
-!- DEVELOPMENTAL STAGE: Weakly expressed at E7 and remains constant
from E11 to E17. {ECO:0000269|PubMed:12801916}.
-!- SIMILARITY: Belongs to the synaptotagmin family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAC27947.1; Type=Frameshift; Positions=322; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB102950; BAC76811.1; -; mRNA.
EMBL; AK032606; BAC27947.1; ALT_FRAME; mRNA.
EMBL; AK137129; BAE23245.1; -; mRNA.
EMBL; BC056932; AAH56932.1; -; mRNA.
CCDS; CCDS49089.1; -. [Q7TN83-2]
RefSeq; NP_766392.2; NM_172804.2. [Q7TN83-2]
RefSeq; XP_006515903.1; XM_006515840.3. [Q7TN83-1]
UniGene; Mm.311393; -.
UniGene; Mm.398210; -.
ProteinModelPortal; Q7TN83; -.
SMR; Q7TN83; -.
iPTMnet; Q7TN83; -.
PhosphoSitePlus; Q7TN83; -.
PeptideAtlas; Q7TN83; -.
PRIDE; Q7TN83; -.
Ensembl; ENSMUST00000221220; ENSMUSP00000152623; ENSMUSG00000044912. [Q7TN83-2]
GeneID; 238266; -.
KEGG; mmu:238266; -.
UCSC; uc007nwu.1; mouse. [Q7TN83-2]
UCSC; uc007nwv.1; mouse. [Q7TN83-1]
CTD; 83851; -.
MGI; MGI:2673872; Syt16.
GeneTree; ENSGT00560000077240; -.
HOGENOM; HOG000220889; -.
HOVERGEN; HBG062897; -.
InParanoid; Q7TN83; -.
KO; K19328; -.
OMA; YAARKMT; -.
OrthoDB; EOG091G099X; -.
PhylomeDB; Q7TN83; -.
TreeFam; TF351132; -.
PRO; PR:Q7TN83; -.
Proteomes; UP000000589; Chromosome 12.
Bgee; ENSMUSG00000044912; -.
CleanEx; MM_SYT16; -.
Genevisible; Q7TN83; MM.
GO; GO:0016021; C:integral component of membrane; ISS:MGI.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0005509; F:calcium ion binding; IBA:GO_Central.
GO; GO:0030276; F:clathrin binding; IBA:GO_Central.
GO; GO:0005543; F:phospholipid binding; IDA:MGI.
GO; GO:0046982; F:protein heterodimerization activity; IPI:MGI.
GO; GO:0042803; F:protein homodimerization activity; IDA:MGI.
GO; GO:0019905; F:syntaxin binding; IBA:GO_Central.
GO; GO:0006887; P:exocytosis; IEA:InterPro.
GO; GO:0006906; P:vesicle fusion; IBA:GO_Central.
Gene3D; 2.60.40.150; -; 2.
InterPro; IPR000008; C2_dom.
InterPro; IPR028690; SYT16.
PANTHER; PTHR10024:SF313; PTHR10024:SF313; 1.
Pfam; PF00168; C2; 2.
SMART; SM00239; C2; 2.
SUPFAM; SSF49562; SSF49562; 2.
PROSITE; PS50004; C2; 2.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Reference proteome; Repeat.
CHAIN 1 639 Synaptotagmin-16.
/FTId=PRO_0000258585.
DOMAIN 346 447 C2 1. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
DOMAIN 501 605 C2 2. {ECO:0000255|PROSITE-
ProRule:PRU00041}.
VAR_SEQ 1 152 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_021381.
VAR_SEQ 1 105 Missing (in isoform 2).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_021382.
VAR_SEQ 106 169 SPTLGQQAEDSSSVIPPWPSKIPGAPKPQPVLSSIAEEDHH
SERQRCGRQHGSGTLEKVNGRKQ -> MATDITPEAIGFLS
AIGVFVVLLAVLLLFINKKLCSENLRGHPYPEQRGKRKHSR
DKTGGHTGT (in isoform 2).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_021384.
VAR_SEQ 153 169 GRQHGSGTLEKVNGRKQ -> MTSKEGGGEGEEIIHN (in
isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_021383.
VAR_SEQ 240 240 E -> EGIHCSALHCRQGQVN (in isoform 2).
{ECO:0000303|PubMed:16141072}.
/FTId=VSP_021385.
CONFLICT 111 111 Q -> K (in Ref. 2; BAC27947).
{ECO:0000305}.
SEQUENCE 639 AA; 71255 MW; F439F2D1009C556A CRC64;
MVLTMASQDV QNFFQPLSSW LSRVYEALQQ AGDALSASLV LLSKHDSALS DKPEQDLDAA
QIQQTYLEDE EQDHDGSPEE ASSLFLEEDH FSLSNSDLQD SVQTASPTLG QQAEDSSSVI
PPWPSKIPGA PKPQPVLSSI AEEDHHSERQ RCGRQHGSGT LEKVNGRKQV NSFGDDEEPS
TSSESDEDVT KQFKISVSRS QSFRSGVSEK GKTTELEQKI KCKRLLCTHQ EDSAEGSACE
DLDRTSQLSY SEILSYEDRP ISILPQSPFE SRNVRHHGPC RPEMGMVRSL GRPCADGVLE
TETAFVSRGF EDSYATHSSS LWSPEEQDGT SLQVPHRLLE PISKCGDLDV IFEYRAVTQK
LTVTIVRAQG LPDKDRSGVN SWQVHIVLLP SKKQRGKTNI QRGPNPVFKE KVTFTKLEPR
DVASCAVRFR LYAARKMTRE RMMGEKLFCL SHLHPEGEMK VTLVLEPRSN LSSGESPLSP
SVVSHSDSAS STQSLSHGGV PELLVGLSYN ATTGRLSVEM IKGSHFRNLA ANRAPDTYGK
LFLLNCVGQE MSRCKTSIRR GQPNPVYKET FVFQVALFQL SDVTLMISIY SRRTMKRKEM
IGWVALGQNS SGEEEQEHWE EMKESKGQQT CRWHTLLES


Related products :

Catalog number Product name Quantity
EIAAB40879 Chr14Syt,Homo sapiens,Human,STREP14,Synaptotagmin 14-like protein,Synaptotagmin XIV-related protein,Synaptotagmin-16,SYT14L,SYT14R,SYT16
EIAAB40878 Mouse,Mus musculus,Strep14,Synaptotagmin 14-like protein,Synaptotagmin XIV-related protein,Synaptotagmin-16,Syt14l,Syt14r,Syt16
EIAAB40868 Rat,Rattus norvegicus,Srg1,Srg1,Synaptotagmin XII,Synaptotagmin-12,Synaptotagmin-related gene 1 protein,Syt12,Sytr1,SytXII
EIAAB40672 Homo sapiens,Human,Putative synaptotagmin-14-like protein,Synaptotagmin XIV-derived protein,Synaptotagmin XIV-like protein,SYT14L,SYTDEP
EIAAB40905 Rat,Rattus norvegicus,Synaptotagmin 5,Synaptotagmin IX,Synaptotagmin V,Synaptotagmin-9,Syt5,Syt9,SytIX
EIAAB40894 Mouse,Mus musculus,Synaptotagmin IX,Synaptotagmin V,Synaptotagmin-5,Syt5,Syt9,SytV
EIAAB40904 Mouse,Mus musculus,Synaptotagmin IX,Synaptotagmin V,Synaptotagmin-9,Syt5,Syt9,SytIX
EIAAB40892 Rat,Rattus norvegicus,Synaptotagmin IX,Synaptotagmin V,Synaptotagmin-5,Syt5,SytV
EIAAB40880 Bk,Mouse,Mus musculus,Protein B_K,Synaptotagmin XVII,Synaptotagmin-17,Syt17,SytXVII
EIAAB40881 Bk,Protein B_K,Rat,Rattus norvegicus,Synaptotagmin XVII,Synaptotagmin-17,Syt17,SytXVII
EIAAB40882 Homo sapiens,Human,Protein B_K,Synaptotagmin XVII,Synaptotagmin-17,SYT17,SytXVII
EIAAB40898 Homo sapiens,Human,IPCA-7,PCANAP7,Prostate cancer-associated protein 7,Synaptotagmin VII,Synaptotagmin-7,SYT7,SytVII
SMC-423D Synaptotagmin-10 Antibody Monoclonal, Clone number: S269-73 Host: Mouse, Isotype: IgG1 Immunogen: Fusion protein amino acids 248-335 (Cytoplasmic C2A domain) of mouse Synaptotagmin-10, accession numbe 100ug
EIAAB40859 Homo sapiens,Human,p65,SVP65,Synaptotagmin I,Synaptotagmin-1,SYT,SYT1,SytI
EIAAB40872 Kiaa1427,Mouse,Mus musculus,Synaptotagmin XIII,Synaptotagmin-13,Syt13,SytXIII
EIAAB40900 Homo sapiens,Human,Synaptotagmin VIII,Synaptotagmin-8,SYT8,SytVIII
EIAAB40877 Chr10Syt,Homo sapiens,Human,Synaptotagmin XV,Synaptotagmin-15,SYT15,SytXV
EIAAB40866 Homo sapiens,Human,KIAA0080,Synaptotagmin XI,Synaptotagmin-11,SYT11,SytXI
EIAAB40890 Homo sapiens,Human,KIAA1342,Synaptotagmin IV,Synaptotagmin-4,SYT4,SytIV
EIAAB40903 Homo sapiens,Human,Synaptotagmin IX,Synaptotagmin-9,SYT9,SytIX
EIAAB40902 Mouse,Mus musculus,Synaptotagmin VIII,Synaptotagmin-8,Syt8,SytVIII
EIAAB40901 Rat,Rattus norvegicus,Synaptotagmin VIII,Synaptotagmin-8,Syt8,SytVIII
EIAAB40897 Homo sapiens,Human,Synaptotagmin VI,Synaptotagmin-6,SYT6,SytVI
EIAAB40885 Homo sapiens,Human,Synaptotagmin II,Synaptotagmin-2,SYT2,SytII
EIAAB40893 Homo sapiens,Human,Synaptotagmin V,Synaptotagmin-5,SYT5,SytV


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur