Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

T-cell surface glycoprotein CD8 beta chain (CD antigen CD8b)

 CD8B_HUMAN              Reviewed;         210 AA.
P10966; P14860; P14861; Q15980; Q496E0; Q496E1; Q496E2; Q9UDB4;
Q9UDB5; Q9UDB6; Q9UDB7; Q9UDB8; Q9UDB9; Q9UDC0; Q9UQ55;
01-JUL-1989, integrated into UniProtKB/Swiss-Prot.
01-JUL-1989, sequence version 1.
25-OCT-2017, entry version 180.
RecName: Full=T-cell surface glycoprotein CD8 beta chain;
AltName: CD_antigen=CD8b;
Flags: Precursor;
Name=CD8B; Synonyms=CD8B1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
TISSUE=T-cell;
PubMed=3145195;
Norment A.M., Littman D.R.;
"A second subunit of CD8 is expressed in human T cells.";
EMBO J. 7:3433-3439(1988).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH CD8A, AND
SUBCELLULAR LOCATION.
PubMed=3145196;
Disanto J.P., Knowles R.W., Flomenberg N.;
"The human Lyt-3 molecule requires CD8 for cell surface expression.";
EMBO J. 7:3465-3470(1988).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=3264320; DOI=10.1084/jem.168.6.1993;
Shiue L., Gorman S.D., Parnes J.R.;
"A second chain of human CD8 is expressed on peripheral blood
lymphocytes.";
J. Exp. Med. 168:1993-2005(1988).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2; 3 AND 4).
PubMed=1541829;
Nakayama K., Kawachi Y., Tokito S., Minami N., Yamamoto R., Imai T.,
Gachelin G., Nakauchi H.;
"Recent duplication of the two human CD8 beta-chain genes.";
J. Immunol. 148:1919-1927(1992).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 5 AND 8).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 162-210 (ISOFORMS 1; 2; 3; 5; 6; 7 AND
8), ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
TISSUE=Peripheral blood;
PubMed=8436166; DOI=10.1002/eji.1830230203;
DiSanto J.P., Smith D., de Bruin D., Lacy E., Flomenberg N.;
"Transcriptional diversity at the duplicated human CD8 beta loci.";
Eur. J. Immunol. 23:320-326(1993).
[8]
FUNCTION, PALMITOYLATION, SUBCELLULAR LOCATION, AND INTERACTION WITH
LCK.
PubMed=10925291;
Arcaro A., Gregoire C., Boucheron N., Stotz S., Palmer E.,
Malissen B., Luescher I.F.;
"Essential role of CD8 palmitoylation in CD8 coreceptor function.";
J. Immunol. 165:2068-2076(2000).
[9]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH LCK.
PubMed=11714755;
Arcaro A., Gregoire C., Bakker T.R., Baldi L., Jordan M., Goffin L.,
Boucheron N., Wurm F., van der Merwe P.A., Malissen B., Luescher I.F.;
"CD8beta endows CD8 with efficient coreceptor function by coupling T
cell receptor/CD3 to raft-associated CD8/p56(lck) complexes.";
J. Exp. Med. 194:1485-1495(2001).
[10]
FUNCTION.
PubMed=17145893; DOI=10.1158/0008-5472.CAN-06-2379;
Lyons G.E., Moore T., Brasic N., Li M., Roszkowski J.J.,
Nishimura M.I.;
"Influence of human CD8 on antigen recognition by T-cell receptor-
transduced cells.";
Cancer Res. 66:11455-11461(2006).
-!- FUNCTION: Integral membrane glycoprotein that plays an essential
role in the immune response and serves multiple functions in
responses against both external and internal offenses. In T-cells,
functions primarily as a coreceptor for MHC class I
molecule:peptide complex. The antigens presented by class I
peptides are derived from cytosolic proteins while class II
derived from extracellular proteins. Interacts simultaneously with
the T-cell receptor (TCR) and the MHC class I proteins presented
by antigen presenting cells (APCs). In turn, recruits the Src
kinase LCK to the vicinity of the TCR-CD3 complex. A
palmitoylation site in the cytoplasmic tail of CD8B chain
contributes to partitioning of CD8 into the plasma membrane lipid
rafts where signaling proteins are enriched. Once LCK recruited,
it initiates different intracellular signaling pathways by
phosphorylating various substrates ultimately leading to
lymphokine production, motility, adhesion and activation of
cytotoxic T-lymphocytes (CTLs). Additionally, plays a critical
role in thymic selection of CD8+ T-cells.
{ECO:0000250|UniProtKB:P10300, ECO:0000269|PubMed:10925291,
ECO:0000269|PubMed:11714755, ECO:0000269|PubMed:17145893}.
-!- SUBUNIT: Forms disulfide-linked heterodimers with CD8A at the cell
surface. Interacts with CD3D; this interaction couples TCR-CD3
with CD8. Interacts with LCK. {ECO:0000250|UniProtKB:P10300,
ECO:0000269|PubMed:10925291, ECO:0000269|PubMed:11714755}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane
{ECO:0000269|PubMed:11714755, ECO:0000269|PubMed:3145196}; Single-
pass type I membrane protein {ECO:0000305}. Note=Requires the
partner CD8A for efficient cell surface expression
(PubMed:3145196). The heterodimer CD8A/CD8B localizes to lipid
rafts due to CD8B cytoplasmic tail palmitoylation.
{ECO:0000269|PubMed:10925291, ECO:0000269|PubMed:11714755,
ECO:0000269|PubMed:3145196}.
-!- SUBCELLULAR LOCATION: Isoform 2: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 3: Secreted {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 4: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 5: Cell membrane {ECO:0000305};
Single-pass type I membrane protein {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 6: Secreted {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 7: Secreted {ECO:0000305}.
-!- SUBCELLULAR LOCATION: Isoform 8: Secreted {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=1; Synonyms=M-1, Mbeta1;
IsoId=P10966-1; Sequence=Displayed;
Name=2; Synonyms=M-3, Mbeta2;
IsoId=P10966-2; Sequence=VSP_002490;
Name=3; Synonyms=S-1, Sbeta3;
IsoId=P10966-3; Sequence=VSP_002492, VSP_002493;
Name=4; Synonyms=M-2;
IsoId=P10966-4; Sequence=VSP_002491;
Name=5; Synonyms=Mbeta3;
IsoId=P10966-6; Sequence=VSP_002493;
Note=Ref.6 (AAI00915) sequence is in conflict in position:
213:I->V. {ECO:0000305};
Name=6; Synonyms=Sbeta1;
IsoId=P10966-7; Sequence=VSP_002492;
Name=7; Synonyms=Sbeta4;
IsoId=P10966-8; Sequence=VSP_039654;
Name=8; Synonyms=Sbeta5;
IsoId=P10966-9; Sequence=VSP_039655;
-!- TISSUE SPECIFICITY: Isoform 1, isoform 3, isoform 5, isoform 6,
isoform 7 and isoform 8 are expressed in both thymus and
peripheral CD8+ T-cells. Expression of isoform 1 is higher in
thymus CD8+ T-cells than in peripheral CD8+ T-cells. Expression of
isoform 6 is higher in peripheral CD8+ T-cells than in thymus CD8+
T-cells. {ECO:0000269|PubMed:8436166}.
-!- PTM: Phosphorylated as a consequence of T-cell activation.
{ECO:0000305}.
-!- PTM: Palmitoylated at the cytoplasmic tail and thereby targets the
heterodimer CD8A/CD8B to lipid rafts unlike CD8A homodimers.
{ECO:0000269|PubMed:10925291}.
-!- SEQUENCE CAUTION:
Sequence=AAD13877.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Wikipedia; Note=CD8 entry;
URL="https://en.wikipedia.org/wiki/CD8";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X13444; CAA31795.1; -; mRNA.
EMBL; X13445; CAA31796.1; -; mRNA.
EMBL; X13446; CAA31797.1; -; mRNA.
EMBL; X13452; CAA31803.1; -; mRNA.
EMBL; Y00805; CAA68750.1; -; mRNA.
EMBL; M36712; AAA35664.1; -; mRNA.
EMBL; S87090; AAB21669.2; -; Genomic_DNA.
EMBL; S87068; AAB21669.2; JOINED; Genomic_DNA.
EMBL; S87070; AAB21669.2; JOINED; Genomic_DNA.
EMBL; S87073; AAB21669.2; JOINED; Genomic_DNA.
EMBL; S87081; AAB21669.2; JOINED; Genomic_DNA.
EMBL; S87087; AAB21670.2; -; Genomic_DNA.
EMBL; S87068; AAB21670.2; JOINED; Genomic_DNA.
EMBL; S87070; AAB21670.2; JOINED; Genomic_DNA.
EMBL; S87073; AAB21670.2; JOINED; Genomic_DNA.
EMBL; S87078; AAB21670.2; JOINED; Genomic_DNA.
EMBL; S87081; AAB21670.2; JOINED; Genomic_DNA.
EMBL; S87083; AAB21671.2; -; Genomic_DNA.
EMBL; S87068; AAB21671.2; JOINED; Genomic_DNA.
EMBL; S87070; AAB21671.2; JOINED; Genomic_DNA.
EMBL; S87073; AAB21671.2; JOINED; Genomic_DNA.
EMBL; S87078; AAB21671.2; JOINED; Genomic_DNA.
EMBL; S87081; AAB21671.2; JOINED; Genomic_DNA.
EMBL; S87083; AAB21672.2; -; Genomic_DNA.
EMBL; S87068; AAB21672.2; JOINED; Genomic_DNA.
EMBL; S87070; AAB21672.2; JOINED; Genomic_DNA.
EMBL; S87073; AAB21672.2; JOINED; Genomic_DNA.
EMBL; S87078; AAB21672.2; JOINED; Genomic_DNA.
EMBL; S87081; AAB21672.2; JOINED; Genomic_DNA.
EMBL; AC111200; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC100911; AAI00912.1; -; mRNA.
EMBL; BC100912; AAI00913.1; -; mRNA.
EMBL; BC100913; AAI00914.1; -; mRNA.
EMBL; BC100914; AAI00915.1; -; mRNA.
EMBL; S55731; AAD13877.1; ALT_SEQ; Genomic_DNA.
EMBL; S55730; AAD13877.1; JOINED; Genomic_DNA.
EMBL; S55733; AAD13877.1; JOINED; Genomic_DNA.
CCDS; CCDS1994.1; -. [P10966-3]
CCDS; CCDS1995.1; -. [P10966-6]
CCDS; CCDS1997.1; -. [P10966-1]
CCDS; CCDS42708.1; -. [P10966-2]
CCDS; CCDS54376.1; -. [P10966-9]
PIR; C49050; C49050.
PIR; D46482; D46482.
PIR; E49050; E49050.
PIR; G49050; G49050.
PIR; S01647; E46482.
PIR; S01873; C46482.
PIR; S01874; B46482.
PIR; T01073; T01073.
RefSeq; NP_001171571.1; NM_001178100.1. [P10966-9]
RefSeq; NP_004922.1; NM_004931.4. [P10966-1]
RefSeq; NP_742099.1; NM_172101.3. [P10966-2]
RefSeq; NP_742100.1; NM_172102.3. [P10966-3]
RefSeq; NP_757362.1; NM_172213.3. [P10966-6]
UniGene; Hs.405667; -.
ProteinModelPortal; P10966; -.
SMR; P10966; -.
BioGrid; 107364; 9.
STRING; 9606.ENSP00000331172; -.
iPTMnet; P10966; -.
PhosphoSitePlus; P10966; -.
BioMuta; CD8B; -.
DMDM; 116032; -.
PaxDb; P10966; -.
PeptideAtlas; P10966; -.
PRIDE; P10966; -.
DNASU; 926; -.
Ensembl; ENST00000331469; ENSP00000331172; ENSG00000172116. [P10966-6]
Ensembl; ENST00000349455; ENSP00000340592; ENSG00000172116. [P10966-3]
Ensembl; ENST00000390655; ENSP00000375070; ENSG00000172116. [P10966-1]
Ensembl; ENST00000393759; ENSP00000377356; ENSG00000172116. [P10966-2]
Ensembl; ENST00000393761; ENSP00000377358; ENSG00000172116. [P10966-9]
GeneID; 926; -.
KEGG; hsa:926; -.
UCSC; uc002srw.4; human. [P10966-1]
CTD; 926; -.
DisGeNET; 926; -.
EuPathDB; HostDB:ENSG00000172116.21; -.
GeneCards; CD8B; -.
HGNC; HGNC:1707; CD8B.
HPA; CAB004353; -.
HPA; HPA029164; -.
MIM; 186730; gene.
neXtProt; NX_P10966; -.
OpenTargets; ENSG00000172116; -.
PharmGKB; PA26245; -.
eggNOG; ENOG410IY5X; Eukaryota.
eggNOG; ENOG410ZF37; LUCA.
GeneTree; ENSGT00510000048998; -.
HOGENOM; HOG000008681; -.
HOVERGEN; HBG105700; -.
InParanoid; P10966; -.
KO; K06459; -.
OMA; IYWLRQR; -.
OrthoDB; EOG091G0T5W; -.
PhylomeDB; P10966; -.
TreeFam; TF338028; -.
Reactome; R-HSA-182218; Nef Mediated CD8 Down-regulation.
Reactome; R-HSA-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
GenomeRNAi; 926; -.
PRO; PR:P10966; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000172116; -.
CleanEx; HS_CD8B; -.
ExpressionAtlas; P10966; baseline and differential.
Genevisible; P10966; HS.
GO; GO:0031901; C:early endosome membrane; TAS:Reactome.
GO; GO:0009897; C:external side of plasma membrane; IEA:Ensembl.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0042101; C:T cell receptor complex; NAS:UniProtKB.
GO; GO:0015026; F:coreceptor activity; NAS:UniProtKB.
GO; GO:0042288; F:MHC class I protein binding; NAS:UniProtKB.
GO; GO:0002250; P:adaptive immune response; IEA:UniProtKB-KW.
GO; GO:0006955; P:immune response; NAS:UniProtKB.
GO; GO:0050690; P:regulation of defense response to virus by virus; TAS:Reactome.
GO; GO:0050776; P:regulation of immune response; TAS:Reactome.
GO; GO:0042110; P:T cell activation; NAS:UniProtKB.
GO; GO:0007169; P:transmembrane receptor protein tyrosine kinase signaling pathway; NAS:UniProtKB.
Gene3D; 2.60.40.10; -; 1.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
InterPro; IPR013106; Ig_V-set.
Pfam; PF07686; V-set; 1.
SMART; SM00409; IG; 1.
SMART; SM00406; IGv; 1.
SUPFAM; SSF48726; SSF48726; 1.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
Adaptive immunity; Alternative splicing; Cell membrane;
Complete proteome; Disulfide bond; Glycoprotein; Immunity;
Immunoglobulin domain; Lipoprotein; Membrane; Palmitate;
Phosphoprotein; Reference proteome; Secreted; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 21
CHAIN 22 210 T-cell surface glycoprotein CD8 beta
chain.
/FTId=PRO_0000014643.
TOPO_DOM 22 170 Extracellular. {ECO:0000255}.
TRANSMEM 171 191 Helical. {ECO:0000255}.
TOPO_DOM 192 210 Cytoplasmic. {ECO:0000255}.
DOMAIN 22 132 Ig-like V-type.
MOD_RES 209 209 Phosphotyrosine. {ECO:0000255}.
CARBOHYD 102 102 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 41 116 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 165 210 GPLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFM
KQFYK -> DFTNKQRIGFWCPATKRHRSVMSTMWKNERRD
TFNPGEFNGC (in isoform 7).
{ECO:0000303|PubMed:8436166}.
/FTId=VSP_039654.
VAR_SEQ 166 210 PLCSPITLGLLVAGVLVLLVSLGVAIHLCCRRRRARLRFMK
QFYK -> LKGKVYQEPLSPNACMDTTAILQPHRSCLTHGS
(in isoform 8).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8436166}.
/FTId=VSP_039655.
VAR_SEQ 166 195 Missing (in isoform 3 and isoform 6).
{ECO:0000303|PubMed:3145195,
ECO:0000303|PubMed:8436166}.
/FTId=VSP_002492.
VAR_SEQ 208 210 FYK -> LRLHPLEKCSRMDY (in isoform 2).
{ECO:0000303|PubMed:3145195,
ECO:0000303|PubMed:8436166}.
/FTId=VSP_002490.
VAR_SEQ 208 210 FYK -> PQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWIL
KT (in isoform 3 and isoform 5).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:3145195,
ECO:0000303|PubMed:8436166}.
/FTId=VSP_002493.
VAR_SEQ 208 210 FYK -> KFNIVCLKISGFTTCCCFQILQISREYGFGVLLQ
KDIGQ (in isoform 4). {ECO:0000305}.
/FTId=VSP_002491.
CONFLICT 173 173 Missing (in Ref. 7; no nucleotide entry).
{ECO:0000305}.
CONFLICT 180 180 V -> I (in Ref. 6; AAI00915).
{ECO:0000305}.
SEQUENCE 210 AA; 23722 MW; 675AD919585F4B80 CRC64;
MRPRLWLLLA AQLTVLHGNS VLQQTPAYIK VQTNKMVMLS CEAKISLSNM RIYWLRQRQA
PSSDSHHEFL ALWDSAKGTI HGEEVEQEKI AVFRDASRFI LNLTSVKPED SGIYFCMIVG
SPELTFGKGT QLSVVDFLPT TAQPTKKSTL KKRVCRLPRP ETQKGPLCSP ITLGLLVAGV
LVLLVSLGVA IHLCCRRRRA RLRFMKQFYK


Related products :

Catalog number Product name Quantity
EIAAB06400 Cd8b,Cd8b1,Ly-3,Lymphocyte antigen 3,Lyt3,Lyt-3,Mouse,Mus musculus,T-cell membrane glycoprotein Ly-3,T-cell surface glycoprotein CD8 beta chain,T-cell surface glycoprotein Lyt-3
EIAAB06399 CD8 antigen 37 kDa chain,Cd8b,Cd8b1,OX-8 membrane antigen,Rat,Rattus norvegicus,T-cell surface glycoprotein CD8 beta chain
20-783-72711 MOUSE ANTI RAT CD8 BETA FITC - T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 0.1 mg
20-783-72712 MOUSE ANTI RAT CD8 BETA - T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 0.1 mg
20-783-72713 MOUSE ANTI RAT CD8 BETA RPE - T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 100 TESTS
20-783-72710 MOUSE ANTI RAT CD8 BETA - T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 0.25 mg
H4355 T-cell surface glycoprotein CD8 beta chain (CD8B), Cat, ELISA Kit 96T
CSB-EL004967CA Cat T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit 96T
CSB-EL004967RA Rat T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit 96T
H4358 T-cell surface glycoprotein CD8 beta chain (CD8B), Rat, ELISA Kit 96T
CSB-EL004967MO Mouse T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit 96T
H4356 T-cell surface glycoprotein CD8 beta chain (CD8B), Human, ELISA Kit 96T
CSB-EL004967HU Human T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit 96T
CSB-EL004967RA Rat T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit SpeciesRat 96T
CSB-EL004967CA Cat T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit SpeciesCat 96T
H4357 T-cell surface glycoprotein CD8 beta chain (CD8B), Mouse, ELISA Kit 96T
CSB-EL004967MO Mouse T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit SpeciesMouse 96T
CSB-EL004967HU Human T-cell surface glycoprotein CD8 beta chain(CD8B) ELISA kit SpeciesHuman 96T
CD8B_RAT ELISA Kit FOR T-cell surface glycoprotein CD8 beta chain; organism: Rat; gene name: Cd8b 96T
EIAAB06401 CD8B,CD8B1,Homo sapiens,Human,T-cell surface glycoprotein CD8 beta chain
CD8B_MOUSE ELISA Kit FOR T-cell surface glycoprotein CD8 beta chain; organism: Mouse; gene name: Cd8b 96T
EIAAB06402 CD8b pseudogene,CD8B2,CD8BP,Homo sapiens,Human,Putative T-cell surface glycoprotein CD8 beta-2 chain
20-783-73907 MOUSE ANTI LAPINE CD8 FITC - T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 0.1 mg
20-783-71692 MOUSE ANTI OVINE CD8 FITC - T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 0.1 mg
20-783-70111 RAT ANTI MOUSE CD8 Azide Free - LY-2; T-cell surface glycoprotein Lyt-3; T-cell membrane glycoprotein Ly-3; Lymphocyte antigen 3; CD8b antigen Monoclonal 1 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur