Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Taste receptor type 1 member 3 (Sweet taste receptor T1R3)

 TS1R3_HUMAN             Reviewed;         852 AA.
Q7RTX0; Q5TA49; Q8NGW9;
04-JAN-2005, integrated into UniProtKB/Swiss-Prot.
29-MAR-2005, sequence version 2.
22-NOV-2017, entry version 140.
RecName: Full=Taste receptor type 1 member 3;
AltName: Full=Sweet taste receptor T1R3;
Flags: Precursor;
Name=TAS1R3; Synonyms=T1R3, TR3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
"Genome-wide discovery and analysis of human seven transmembrane helix
receptor genes.";
Submitted (JUL-2001) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[3]
IDENTIFICATION, AND FUNCTION.
PubMed=11917125; DOI=10.1073/pnas.072090199;
Li X., Staszewski L., Xu H., Durick K., Zoller M., Adler E.;
"Human receptors for sweet and umami taste.";
Proc. Natl. Acad. Sci. U.S.A. 99:4692-4696(2002).
[4]
FUNCTION.
PubMed=12892531; DOI=10.1290/1543-706X(2003)039<0080:TRTIAE>2.0.CO;2;
Ariyasu T., Matsumoto S., Kyono F., Hanaya T., Arai S., Ikeda M.,
Kurimoto M.;
"Taste receptor T1R3 is an essential molecule for the cellular
recognition of the disaccharide trehalose.";
In Vitro Cell. Dev. Biol. Anim. 39:80-88(2003).
[5]
REGION IMPLICATED IN SWEET RECEPTOR FUNCTION, AND MUTAGENESIS OF
ALA-537 AND PHE-540.
PubMed=15299024; DOI=10.1074/jbc.M406779200;
Jiang P., Ji Q., Liu Z., Snyder L.A., Benard L.M.J., Margolskee R.F.,
Max M.;
"The cysteine-rich region of T1R3 determines responses to intensely
sweet proteins.";
J. Biol. Chem. 279:45068-45075(2004).
-!- FUNCTION: Putative taste receptor. TAS1R1/TAS1R3 responds to the
umami taste stimulus (the taste of monosodium glutamate).
TAS1R2/TAS1R3 recognizes diverse natural and synthetic sweeteners.
TAS1R3 is essential for the recognition and response to the
disaccharide trehalose (By similarity). Sequence differences
within and between species can significantly influence the
selectivity and specificity of taste responses. {ECO:0000250,
ECO:0000269|PubMed:11917125, ECO:0000269|PubMed:12892531}.
-!- SUBUNIT: Forms homodimers or heterodimers with TAS1R1 and TAS1R2.
-!- SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.
-!- SIMILARITY: Belongs to the G-protein coupled receptor 3 family.
TAS1R subfamily. {ECO:0000305}.
-!- WEB RESOURCE: Name=Protein Spotlight; Note=The taste experience
- Issue 55 of February 2005;
URL="https://web.expasy.org/spotlight/back_issues/055";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB065647; BAC05873.1; -; Genomic_DNA.
EMBL; AL139287; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BK000152; DAA00013.1; -; mRNA.
CCDS; CCDS30556.1; -.
RefSeq; NP_689414.1; NM_152228.2.
UniGene; Hs.74375; -.
ProteinModelPortal; Q7RTX0; -.
SMR; Q7RTX0; -.
BioGrid; 123757; 2.
STRING; 9606.ENSP00000344411; -.
ChEMBL; CHEMBL1613742; -.
BioMuta; TAS1R3; -.
DMDM; 62299063; -.
EPD; Q7RTX0; -.
PaxDb; Q7RTX0; -.
PeptideAtlas; Q7RTX0; -.
PRIDE; Q7RTX0; -.
DNASU; 83756; -.
Ensembl; ENST00000339381; ENSP00000344411; ENSG00000169962.
GeneID; 83756; -.
KEGG; hsa:83756; -.
UCSC; uc010nyk.3; human.
CTD; 83756; -.
DisGeNET; 83756; -.
EuPathDB; HostDB:ENSG00000169962.4; -.
GeneCards; TAS1R3; -.
HGNC; HGNC:15661; TAS1R3.
HPA; HPA053439; -.
MIM; 605865; gene.
neXtProt; NX_Q7RTX0; -.
OpenTargets; ENSG00000169962; -.
PharmGKB; PA38012; -.
eggNOG; KOG1056; Eukaryota.
eggNOG; ENOG410XR6W; LUCA.
GeneTree; ENSGT00760000118884; -.
HOGENOM; HOG000231293; -.
HOVERGEN; HBG098572; -.
InParanoid; Q7RTX0; -.
KO; K04626; -.
OMA; CFGLACL; -.
OrthoDB; EOG091G01UW; -.
PhylomeDB; Q7RTX0; -.
TreeFam; TF331269; -.
Reactome; R-HSA-420499; Class C/3 (Metabotropic glutamate/pheromone receptors).
GeneWiki; TAS1R3; -.
GenomeRNAi; 83756; -.
PRO; PR:Q7RTX0; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000169962; -.
CleanEx; HS_TAS1R3; -.
GO; GO:0016021; C:integral component of membrane; IC:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:1903767; C:sweet taste receptor complex; IDA:BHF-UCL.
GO; GO:0004930; F:G-protein coupled receptor activity; IEA:UniProtKB-KW.
GO; GO:0046982; F:protein heterodimerization activity; NAS:UniProtKB.
GO; GO:0008527; F:taste receptor activity; IDA:UniProtKB.
GO; GO:0001582; P:detection of chemical stimulus involved in sensory perception of sweet taste; IDA:HGNC.
GO; GO:0007186; P:G-protein coupled receptor signaling pathway; IC:HGNC.
GO; GO:0050916; P:sensory perception of sweet taste; IDA:UniProtKB.
GO; GO:0050917; P:sensory perception of umami taste; IDA:UniProtKB.
InterPro; IPR001828; ANF_lig-bd_rcpt.
InterPro; IPR000337; GPCR_3.
InterPro; IPR011500; GPCR_3_9-Cys_dom.
InterPro; IPR017978; GPCR_3_C.
InterPro; IPR017979; GPCR_3_CS.
InterPro; IPR028082; Peripla_BP_I.
Pfam; PF00003; 7tm_3; 1.
Pfam; PF01094; ANF_receptor; 1.
Pfam; PF07562; NCD3G; 1.
PRINTS; PR00248; GPCRMGR.
SUPFAM; SSF53822; SSF53822; 1.
PROSITE; PS00980; G_PROTEIN_RECEP_F3_2; 1.
PROSITE; PS50259; G_PROTEIN_RECEP_F3_4; 1.
1: Evidence at protein level;
Cell membrane; Complete proteome; G-protein coupled receptor;
Glycoprotein; Membrane; Polymorphism; Receptor; Reference proteome;
Sensory transduction; Signal; Taste; Transducer; Transmembrane;
Transmembrane helix.
SIGNAL 1 20 {ECO:0000255}.
CHAIN 21 852 Taste receptor type 1 member 3.
/FTId=PRO_0000012961.
TOPO_DOM 21 570 Extracellular. {ECO:0000255}.
TRANSMEM 571 591 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 592 603 Cytoplasmic. {ECO:0000255}.
TRANSMEM 604 624 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 625 639 Extracellular. {ECO:0000255}.
TRANSMEM 640 660 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 661 682 Cytoplasmic. {ECO:0000255}.
TRANSMEM 683 703 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 704 729 Extracellular. {ECO:0000255}.
TRANSMEM 730 750 Helical; Name=5. {ECO:0000255}.
TOPO_DOM 751 762 Cytoplasmic. {ECO:0000255}.
TRANSMEM 763 783 Helical; Name=6. {ECO:0000255}.
TOPO_DOM 784 789 Extracellular. {ECO:0000255}.
TRANSMEM 790 810 Helical; Name=7. {ECO:0000255}.
TOPO_DOM 811 852 Cytoplasmic. {ECO:0000255}.
REGION 536 545 Required for brazzein responsiveness.
CARBOHYD 85 85 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 130 130 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 264 264 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 285 285 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 380 380 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 411 411 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 432 432 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 475 475 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VARIANT 757 757 C -> R (in dbSNP:rs307377).
/FTId=VAR_020788.
MUTAGEN 537 537 A->G: Retains partial activity toward
brazzein; however response to other
sweeteners tested is suppressed.
{ECO:0000269|PubMed:15299024}.
MUTAGEN 537 537 A->P: Receptor unresponsive to all
sweeteners tested.
{ECO:0000269|PubMed:15299024}.
MUTAGEN 537 537 A->T,S,E,V: Abolished the response to
brazzein. {ECO:0000269|PubMed:15299024}.
MUTAGEN 540 540 F->A,H: Reduces the response to brazzein
and monellin.
{ECO:0000269|PubMed:15299024}.
MUTAGEN 540 540 F->L: Reduces the response to monellin.
{ECO:0000269|PubMed:15299024}.
MUTAGEN 540 540 F->Y,P: Reduces the response to brazzein;
P-540 also enhances responses to the
small molecule sweeteners.
{ECO:0000269|PubMed:15299024}.
CONFLICT 852 852 E -> EAPILHPARHHSSGRPGGGTQAYAQGRARRGRGGTQ
LPTLPFAQWVDSIMTVTSTRDRAQDLTPARRQAHTGSPVRV
PGSAPSRA (in Ref. 1; BAC05873).
{ECO:0000305}.
SEQUENCE 852 AA; 93386 MW; 9690DEC23E75EB3E CRC64;
MLGPAVLGLS LWALLHPGTG APLCLSQQLR MKGDYVLGGL FPLGEAEEAG LRSRTRPSSP
VCTRFSSNGL LWALAMKMAV EEINNKSDLL PGLRLGYDLF DTCSEPVVAM KPSLMFLAKA
GSRDIAAYCN YTQYQPRVLA VIGPHSSELA MVTGKFFSFF LMPQVSYGAS MELLSARETF
PSFFRTVPSD RVQLTAAAEL LQEFGWNWVA ALGSDDEYGR QGLSIFSALA AARGICIAHE
GLVPLPRADD SRLGKVQDVL HQVNQSSVQV VLLFASVHAA HALFNYSISS RLSPKVWVAS
EAWLTSDLVM GLPGMAQMGT VLGFLQRGAQ LHEFPQYVKT HLALATDPAF CSALGEREQG
LEEDVVGQRC PQCDCITLQN VSAGLNHHQT FSVYAAVYSV AQALHNTLQC NASGCPAQDP
VKPWQLLENM YNLTFHVGGL PLRFDSSGNV DMEYDLKLWV WQGSVPRLHD VGRFNGSLRT
ERLKIRWHTS DNQKPVSRCS RQCQEGQVRR VKGFHSCCYD CVDCEAGSYR QNPDDIACTF
CGQDEWSPER STRCFRRRSR FLAWGEPAVL LLLLLLSLAL GLVLAALGLF VHHRDSPLVQ
ASGGPLACFG LVCLGLVCLS VLLFPGQPSP ARCLAQQPLS HLPLTGCLST LFLQAAEIFV
ESELPLSWAD RLSGCLRGPW AWLVVLLAML VEVALCTWYL VAFPPEVVTD WHMLPTEALV
HCRTRSWVSF GLAHATNATL AFLCFLGTFL VRSQPGCYNR ARGLTFAMLA YFITWVSFVP
LLANVQVVLR PAVQMGALLL CVLGILAAFH LPRCYLLMRQ PGLNTPEFFL GGGPGDAQGQ
NDGNTGNQGK HE


Related products :

Catalog number Product name Quantity
EIAAB44174 Mouse,Mus musculus,Sac,Saccharin preference protein,Sweet taste receptor T1R3,T1r3,Tas1r3,Taste receptor type 1 member 3,Tr3
EIAAB44177 Homo sapiens,Human,Sweet taste receptor T1R3,T1R3,TAS1R3,Taste receptor type 1 member 3,TR3
EIAAB44175 Rat,Rattus norvegicus,Sweet taste receptor T1R3,T1r3,Tas1r3,Taste receptor type 1 member 3,Tr3
EIAAB44176 Canis familiaris,Canis lupus familiaris,Dog,Sweet taste receptor T1R3,T1R3,TAS1R3,Taste receptor type 1 member 3
18-461-10709 Taste receptor type 1 member 2 - G-protein coupled receptor 71; Sweet taste receptor T1R2 Polyclonal 0.05 ml
EIAAB44170 GPR71,G-protein coupled receptor 71,Homo sapiens,Human,Sweet taste receptor T1R2,T1R2,TAS1R2,Taste receptor type 1 member 2,TR2
EIAAB44171 Gpr71,G-protein coupled receptor 71,Mouse,Mus musculus,Sweet taste receptor T1R2,T1r2,Tas1r2,Taste receptor type 1 member 2,Tr2
EIAAB44172 Gpr71,G-protein coupled receptor 71,Rat,Rattus norvegicus,Sweet taste receptor T1R2,T1r2,Tas1r2,Taste receptor type 1 member 2,Tr2
EIAAB43709 Rat,Rattus norvegicus,T2R123,T2R2,T2R23,Tas2r123,Tas2r14,Tas2r2,Tas2r23,Taste receptor type 2 member 123,Taste receptor type 2 member 2,Taste receptor type 2 member 23
EIAAB43724 Mouse,mT2r64,mTRB3,mTRB5,Mus musculus,T2R13,T2R140,T2R40,T2r64,T2R8,Tas2r13,Tas2r137,Tas2r140,Tas2r40,Tas2r8,Taste receptor family B member 3,Taste receptor type 2 member 140,Taste receptor type 2 mem
EIAAB43674 Mouse,Mus musculus,T2R10,T2R103,Tas2r10,Tas2r103,Taste receptor family B member 2,Taste receptor type 2 member 10,Taste receptor type 2 member 103,TRB2
EIAAB43678 Mouse,Mus musculus,T2R105,T2R5,T2R9,Tas2r105,Tas2r5,Tas2r9,Taste receptor type 2 member 105,Taste receptor type 2 member 5,Taste receptor type 2 member 9
EIAAB43704 Rat,Rattus norvegicus,T2R1,T2R119,T2R19,Tas2r1,Tas2r119,Tas2r19,Taste receptor type 2 member 1,Taste receptor type 2 member 119,Taste receptor type 2 member 19
EIAAB41120 Homo sapiens,Human,T2R31,T2R44,T2R53,TAS2R31,TAS2R44,Taste receptor type 2 member 31,Taste receptor type 2 member 44,Taste receptor type 2 member 53
EIAAB41122 Homo sapiens,Human,PTC,PTC bitter taste receptor,T2R38,T2R61,TAS2R38,Taste receptor type 2 member 38,Taste receptor type 2 member 61
EIAAB41117 Homo sapiens,Human,T2R48,TAS2R19,TAS2R23,TAS2R48,Taste receptor type 2 member 19,Taste receptor type 2 member 23,Taste receptor type 2 member 48
EIAAB41118 Homo sapiens,Human,T2R49,T2R56,TAS2R20,TAS2R49,Taste receptor type 2 member 20,Taste receptor type 2 member 49,Taste receptor type 2 member 56
002-75 Sweet Taste Receptor T1R3 (819_839)(Mouse) _ 100ug 100 µg
EIAAB44173 Canis familiaris,Canis lupus familiaris,Dog,Sweet taste receptor T1R2,T1R2,TAS1R2,Taste receptor type 1 member 2
EIAAB41127 GPR60,G-protein coupled receptor 60,Homo sapiens,Human,T2R40,T2R58,TAS2R40,Taste receptor type 2 member 40,Taste receptor type 2 member 58
T1R31-A Anti_Rat Taste Receptor type 1 member 3 (T1R3) IgG (aff pure) 100 ug
T1R31-A Anti-Rat Taste Receptor type 1 member 3 (T1R3) IgG (aff pure) 100 ug
T1R31-P Anti_Rat Taste Receptor type 1 member 3 (T1R3) Control_blocking peptide 1 100 ug
EIAAB43708 Mouse,mT2R55,Mus musculus,STC9-2,T2R123,T2R23,T2r55,Tas2r123,Tas2r23,Taste receptor type 2 member 123,Taste receptor type 2 member 23
EIAAB41186 Homo sapiens,Human,T2R7,TAS2R7,Taste receptor family B member 4,Taste receptor type 2 member 7,TRB4


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur