Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Tetraspanin-12 (Tspan-12) (Tetraspan NET-2) (Transmembrane 4 superfamily member 12)

 TSN12_HUMAN             Reviewed;         305 AA.
O95859; A4D0V8; B4DRG6; Q549U9; Q8N5Y0;
01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
01-MAY-1999, sequence version 1.
18-JUL-2018, entry version 135.
RecName: Full=Tetraspanin-12;
Short=Tspan-12;
AltName: Full=Tetraspan NET-2;
AltName: Full=Transmembrane 4 superfamily member 12;
Name=TSPAN12; Synonyms=NET2, TM4SF12; ORFNames=UNQ774/PRO1568;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=10719184; DOI=10.1016/S0167-4838(00)00022-4;
Serru V., Dessen P., Boucheix C., Rubinstein E.;
"Sequence and expression of seven new tetraspans.";
Biochim. Biophys. Acta 1478:159-163(2000).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Adrenal gland, and Teratocarcinoma;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12690205; DOI=10.1126/science.1083423;
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K.,
Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R.,
Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A.,
Kanematsu E., Gentles S., Christopoulos C.C., Choufani S.,
Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z.,
Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C.,
Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J.,
Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F.,
Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F.,
Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H.,
Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G.,
Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P.,
Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J.,
Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F.,
Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B.,
Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H.,
Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W.,
Mural R.J., Adams M.D., Tsui L.-C.;
"Human chromosome 7: DNA sequence and biology.";
Science 300:767-772(2003).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
SER-57.
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
FUNCTION, INTERACTION WITH ADAM10, PALMITOYLATION, AND MUTAGENESIS OF
CYS-9; CYS-12 AND CYS-83.
PubMed=19587294; DOI=10.1096/fj.09-133462;
Xu D., Sharma C., Hemler M.E.;
"Tetraspanin12 regulates ADAM10-dependent cleavage of amyloid
precursor protein.";
FASEB J. 23:3674-3681(2009).
[8]
FUNCTION.
PubMed=19211836; DOI=10.1091/mbc.E08-11-1149;
Lafleur M.A., Xu D., Hemler M.E.;
"Tetraspanin proteins regulate membrane type-1 matrix
metalloproteinase-dependent pericellular proteolysis.";
Mol. Biol. Cell 20:2030-2040(2009).
[9]
VARIANTS EVR5 ARG-188 AND PRO-237.
PubMed=20159111; DOI=10.1016/j.ajhg.2009.12.016;
Nikopoulos K., Gilissen C., Hoischen A., van Nouhuys C.E.,
Boonstra F.N., Blokland E.A., Arts P., Wieskamp N., Strom T.M.,
Ayuso C., Tilanus M.A., Bouwhuis S., Mukhopadhyay A., Scheffer H.,
Hoefsloot L.H., Veltman J.A., Cremers F.P., Collin R.W.;
"Next-generation sequencing of a 40 Mb linkage interval reveals
TSPAN12 mutations in patients with familial exudative
vitreoretinopathy.";
Am. J. Hum. Genet. 86:240-247(2010).
[10]
VARIANTS EVR5 HIS-101 AND ARG-210.
PubMed=20159112; DOI=10.1016/j.ajhg.2010.01.012;
Poulter J.A., Ali M., Gilmour D.F., Rice A., Kondo H., Hayashi K.,
Mackey D.A., Kearns L.S., Ruddle J.B., Craig J.E., Pierce E.A.,
Downey L.M., Mohamed M.D., Markham A.F., Inglehearn C.F., Toomes C.;
"Mutations in TSPAN12 cause autosomal-dominant familial exudative
vitreoretinopathy.";
Am. J. Hum. Genet. 86:248-253(2010).
[11]
VARIANTS EVR5 MET-49; CYS-138 AND PRO-223.
PubMed=22427576; DOI=10.1167/iovs.11-8629;
Poulter J.A., Davidson A.E., Ali M., Gilmour D.F., Parry D.A.,
Mintz-Hittner H.A., Carr I.M., Bottomley H.M., Long V.W., Downey L.M.,
Sergouniotis P.I., Wright G.A., MacLaren R.E., Moore A.T.,
Webster A.R., Inglehearn C.F., Toomes C.;
"Recessive mutations in TSPAN12 cause retinal dysplasia and severe
familial exudative vitreoretinopathy (FEVR).";
Invest. Ophthalmol. Vis. Sci. 53:2873-2879(2012).
-!- FUNCTION: Regulator of cell surface receptor signal transduction.
Plays a central role in retinal vascularization by regulating
norrin (NDP) signal transduction. Acts in concert with norrin
(NDP) to promote FZD4 multimerization and subsequent activation of
FZD4, leading to promote accumulation of beta-catenin (CTNNB1) and
stimulate LEF/TCF-mediated transcriptional programs. Suprisingly,
it only activate the norrin (NDP)-dependent activation of FZD4,
while it does not activate the Wnt-dependent activation of FZD4,
suggesting the existence of a Wnt-independent signaling that also
promote accumulation the beta-catenin (CTNNB1) (By similarity).
Acts as a regulator of membrane proteinases such as ADAM10 and
MMP14/MT1-MMP. Activates ADAM10-dependent cleavage activity of
amyloid precursor protein (APP). Activates MMP14/MT1-MMP-dependent
cleavage activity. {ECO:0000250, ECO:0000269|PubMed:19211836,
ECO:0000269|PubMed:19587294}.
-!- SUBUNIT: Component of a complex, at least composed of TSPAN12,
FZD4 and norrin (NDP) (By similarity). Interacts (when
palmitoylated) with ADAM10. Interacts with MMP14/MT1-MMP.
{ECO:0000250, ECO:0000269|PubMed:19587294}.
-!- INTERACTION:
Q12800:TFCP2; NbExp=3; IntAct=EBI-2466403, EBI-717422;
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Multi-pass
membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=O95859-1; Sequence=Displayed;
Name=2;
IsoId=O95859-2; Sequence=VSP_038525;
Note=No experimental confirmation available.;
-!- PTM: Palmitoylated; required for interaction with ADAM10. The
precise position of palmitoylated residues is unclear and occurs
either on Cys-9, Cys-12 and/or Cys-83.
{ECO:0000269|PubMed:19587294}.
-!- DISEASE: Vitreoretinopathy, exudative 5 (EVR5) [MIM:613310]: A
disorder of the retinal vasculature characterized by an abrupt
cessation of growth of peripheral capillaries, leading to an
avascular peripheral retina. This may lead to compensatory retinal
neovascularization, which is thought to be induced by hypoxia from
the initial avascular insult. New vessels are prone to leakage and
rupture causing exudates and bleeding, followed by scarring,
retinal detachment and blindness. Clinical features can be highly
variable, even within the same family. Patients with mild forms of
the disease are asymptomatic, and their only disease related
abnormality is an arc of avascular retina in the extreme temporal
periphery. {ECO:0000269|PubMed:20159111,
ECO:0000269|PubMed:20159112, ECO:0000269|PubMed:22427576}.
Note=The disease is caused by mutations affecting the gene
represented in this entry. TSPAN12 dominant and recessive
mutations have been identified in patients with exudative
vitreoretinopathy. Patients with mutations in both alleles of
TSPAN12 have severe exudative vitreoretinopathy or retinal
dysplasia. These mutations appear to result in a milder phenotype
in heterozygous mutation carriers (PubMed:22427576).
{ECO:0000269|PubMed:22427576}.
-!- SIMILARITY: Belongs to the tetraspanin (TM4SF) family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF124522; AAD17317.1; -; mRNA.
EMBL; AY358703; AAQ89066.1; -; mRNA.
EMBL; AK299247; BAG61278.1; -; mRNA.
EMBL; AK312239; BAG35172.1; -; mRNA.
EMBL; AC004456; AAQ96879.1; -; Genomic_DNA.
EMBL; CH236947; EAL24349.1; -; Genomic_DNA.
EMBL; BC031265; AAH31265.1; -; mRNA.
CCDS; CCDS5777.1; -. [O95859-1]
RefSeq; NP_036470.1; NM_012338.3. [O95859-1]
RefSeq; XP_005250296.1; XM_005250239.2. [O95859-1]
RefSeq; XP_011514295.1; XM_011515993.1. [O95859-1]
RefSeq; XP_011514296.1; XM_011515994.1. [O95859-1]
RefSeq; XP_016867401.1; XM_017011912.1. [O95859-1]
UniGene; Hs.16529; -.
ProteinModelPortal; O95859; -.
BioGrid; 117098; 1.
IntAct; O95859; 21.
STRING; 9606.ENSP00000222747; -.
TCDB; 8.A.40.1.20; the tetraspanin (tetraspanin) family.
iPTMnet; O95859; -.
PhosphoSitePlus; O95859; -.
BioMuta; TSPAN12; -.
MaxQB; O95859; -.
PaxDb; O95859; -.
PRIDE; O95859; -.
ProteomicsDB; 51092; -.
ProteomicsDB; 51093; -. [O95859-2]
DNASU; 23554; -.
Ensembl; ENST00000222747; ENSP00000222747; ENSG00000106025. [O95859-1]
Ensembl; ENST00000415871; ENSP00000397699; ENSG00000106025. [O95859-1]
GeneID; 23554; -.
KEGG; hsa:23554; -.
UCSC; uc003vjk.4; human. [O95859-1]
CTD; 23554; -.
DisGeNET; 23554; -.
EuPathDB; HostDB:ENSG00000106025.8; -.
GeneCards; TSPAN12; -.
GeneReviews; TSPAN12; -.
HGNC; HGNC:21641; TSPAN12.
HPA; HPA051570; -.
HPA; HPA058244; -.
MalaCards; TSPAN12; -.
MIM; 613138; gene.
MIM; 613310; phenotype.
neXtProt; NX_O95859; -.
OpenTargets; ENSG00000106025; -.
Orphanet; 891; Familial exudative vitreoretinopathy.
PharmGKB; PA134954047; -.
eggNOG; KOG3882; Eukaryota.
eggNOG; ENOG4111IRY; LUCA.
GeneTree; ENSGT00510000047764; -.
HOGENOM; HOG000252919; -.
HOVERGEN; HBG054253; -.
InParanoid; O95859; -.
KO; K17355; -.
OMA; MITLKAR; -.
OrthoDB; EOG091G0G2A; -.
PhylomeDB; O95859; -.
TreeFam; TF316345; -.
SIGNOR; O95859; -.
ChiTaRS; TSPAN12; human.
GeneWiki; TSPAN12; -.
GenomeRNAi; 23554; -.
PRO; PR:O95859; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000106025; -.
CleanEx; HS_TSPAN12; -.
ExpressionAtlas; O95859; baseline and differential.
Genevisible; O95859; HS.
GO; GO:0016021; C:integral component of membrane; TAS:ProtInc.
GO; GO:0005887; C:integral component of plasma membrane; ISS:UniProtKB.
GO; GO:0016020; C:membrane; TAS:ProtInc.
GO; GO:0001525; P:angiogenesis; IEA:UniProtKB-KW.
GO; GO:0007166; P:cell surface receptor signaling pathway; ISS:UniProtKB.
GO; GO:0045765; P:regulation of angiogenesis; ISS:UniProtKB.
GO; GO:0010842; P:retina layer formation; ISS:UniProtKB.
Gene3D; 1.10.1450.10; -; 1.
InterPro; IPR000301; Tetraspanin.
InterPro; IPR018499; Tetraspanin/Peripherin.
InterPro; IPR018503; Tetraspanin_CS.
InterPro; IPR008952; Tetraspanin_EC2_sf.
Pfam; PF00335; Tetraspannin; 1.
PIRSF; PIRSF002419; Tetraspanin; 1.
PRINTS; PR00259; TMFOUR.
SUPFAM; SSF48652; SSF48652; 1.
PROSITE; PS00421; TM4_1; 1.
1: Evidence at protein level;
Alternative splicing; Angiogenesis; Cell membrane; Complete proteome;
Disease mutation; Lipoprotein; Membrane; Palmitate; Polymorphism;
Reference proteome; Transmembrane; Transmembrane helix.
CHAIN 1 305 Tetraspanin-12.
/FTId=PRO_0000219257.
TOPO_DOM 1 12 Cytoplasmic. {ECO:0000255}.
TRANSMEM 13 33 Helical. {ECO:0000255}.
TOPO_DOM 34 59 Extracellular. {ECO:0000255}.
TRANSMEM 60 80 Helical. {ECO:0000255}.
TOPO_DOM 81 89 Cytoplasmic. {ECO:0000255}.
TRANSMEM 90 110 Helical. {ECO:0000255}.
TOPO_DOM 111 224 Extracellular. {ECO:0000255}.
TRANSMEM 225 245 Helical. {ECO:0000255}.
TOPO_DOM 246 305 Cytoplasmic. {ECO:0000255}.
LIPID 9 9 S-palmitoyl cysteine. {ECO:0000250}.
LIPID 12 12 S-palmitoyl cysteine. {ECO:0000250}.
LIPID 83 83 S-palmitoyl cysteine. {ECO:0000250}.
VAR_SEQ 1 120 MAREDSVKCLRCLLYALNLLFWLMSISVLAVSAWMRDYLNN
VLTLTAETRVEEAVILTYFPVVHPVMIAVCCFLIIVGMLGY
CGTVKRNLLLLAWYFGSLLVIFCVELACGVWTYEQELM ->
MAHKLLL (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_038525.
VARIANT 49 49 T -> M (in EVR5; dbSNP:rs538591733).
{ECO:0000269|PubMed:22427576}.
/FTId=VAR_068899.
VARIANT 57 57 L -> S (in dbSNP:rs17852934).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_062253.
VARIANT 101 101 L -> H (in EVR5; dbSNP:rs267607152).
{ECO:0000269|PubMed:20159112}.
/FTId=VAR_063576.
VARIANT 138 138 Y -> C (in EVR5; dbSNP:rs587777283).
{ECO:0000269|PubMed:22427576}.
/FTId=VAR_068900.
VARIANT 188 188 G -> R (in EVR5; dbSNP:rs267607151).
{ECO:0000269|PubMed:20159111}.
/FTId=VAR_063577.
VARIANT 210 210 M -> R (in EVR5).
{ECO:0000269|PubMed:20159112}.
/FTId=VAR_063578.
VARIANT 223 223 L -> P (in EVR5).
{ECO:0000269|PubMed:22427576}.
/FTId=VAR_068901.
VARIANT 237 237 A -> P (in EVR5; dbSNP:rs267607154).
{ECO:0000269|PubMed:20159111}.
/FTId=VAR_063579.
MUTAGEN 9 9 C->S: Impairs interaction with ADAM10;
when associated with S-12 and S-83.
{ECO:0000269|PubMed:19587294}.
MUTAGEN 12 12 C->S: Impairs interaction with ADAM10;
when associated with S-9 and S-83.
{ECO:0000269|PubMed:19587294}.
MUTAGEN 83 83 C->S: Impairs interaction with ADAM10;
when associated with S-9 and S-12.
{ECO:0000269|PubMed:19587294}.
SEQUENCE 305 AA; 35383 MW; EBF4D5E1371E92DC CRC64;
MAREDSVKCL RCLLYALNLL FWLMSISVLA VSAWMRDYLN NVLTLTAETR VEEAVILTYF
PVVHPVMIAV CCFLIIVGML GYCGTVKRNL LLLAWYFGSL LVIFCVELAC GVWTYEQELM
VPVQWSDMVT LKARMTNYGL PRYRWLTHAW NFFQREFKCC GVVYFTDWLE MTEMDWPPDS
CCVREFPGCS KQAHQEDLSD LYQEGCGKKM YSFLRGTKQL QVLRFLGISI GVTQILAMIL
TITLLWALYY DRREPGTDQM MSLKNDNSQH LSCPSVELLK PSLSRIFEHT SMANSFNTHF
EMEEL


Related products :

Catalog number Product name Quantity
EIAAB44276 Mouse,Mus musculus,Tetraspan NET-4,Tetraspanin-5,Tm4sf9,Transmembrane 4 superfamily member 9,Tspan5,Tspan-5
EIAAB44278 Homo sapiens,Human,Tetraspan NET-4,Tetraspanin-5,TM4SF9,Transmembrane 4 superfamily member 9,TSPAN5,Tspan-5
EIAAB44240 Homo sapiens,Human,NET2,Tetraspan NET-2,Tetraspanin-12,TM4SF12,Transmembrane 4 superfamily member 12,TSPAN12,Tspan-12,UNQ774_PRO1568
EIAAB44248 Homo sapiens,Human,NET7,Tetraspan NET-7,Tetraspanin-15,TM4SF15,Transmembrane 4 superfamily member 15,TSPAN15,Tspan-15,UNQ677_PRO1311
EIAAB44243 Homo sapiens,Human,NET6,Tetraspan NET-6,Tetraspanin-13,TM4SF13,Transmembrane 4 superfamily member 13,TSPAN13,Tspan-13,UNQ260_PRO296
EIAAB44250 F-box only protein 23,Fbxo23,Mouse,Mus musculus,Tetraspan protein SB134,Tetraspanin-17,Tm4sf17,Transmembrane 4 superfamily member 17,Tspan17,Tspan-17
EIAAB44252 F-box only protein 23,FBXO23,Homo sapiens,Human,Tetraspan protein SB134,Tetraspanin-17,TM4SF17,Transmembrane 4 superfamily member 17,TSPAN17,Tspan-17
EIAAB44249 Homo sapiens,Human,Tetraspanin TM4-B,Tetraspanin-16,TM4SF16,Transmembrane 4 superfamily member 16,TSPAN16,Tspan-16
EIAAB44262 Mouse,Mus musculus,OAP-1,OSP-associated protein 1,Tetraspanin TM4-A,Tetraspanin-3,Tm4sf8,Transmembrane 4 superfamily member 8,Tspan3,Tspan-3
EIAAB44261 Homo sapiens,Human,Tetraspanin TM4-A,Tetraspanin-3,TM4SF8,Transmembrane 4 superfamily member 8,TSPAN3,Tspan-3
15-288-22842 Tetraspanin-8 - Tspan-8; Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029 Polyclonal 0.05 mg
15-288-22842 Tetraspanin-8 - Tspan-8; Transmembrane 4 superfamily member 3; Tumor-associated antigen CO-029 Polyclonal 0.1 mg
EIAAB44238 Rat,Rattus norvegicus,Tetraspanin-12,Tm4sf12,Transmembrane 4 superfamily member 12,Tspan12,Tspan-12
EIAAB44275 Mouse,Mus musculus,Tetraspanin-4,Tm4sf7,Transmembrane 4 superfamily member 7,Tspan4,Tspan-4
EIAAB44244 Mouse,Mus musculus,Tetraspanin-13,Tm4sf13,Transmembrane 4 superfamily member 13,Tspan13,Tspan-13
EIAAB44277 Rat,Rattus norvegicus,Tetraspanin-5,Tm4sf9,Transmembrane 4 superfamily member 9,Tspan5,Tspan-5
EIAAB44242 Rat,Rattus norvegicus,Tetraspanin-13,Tm4sf13,Transmembrane 4 superfamily member 13,Tspan13,Tspan-13
EIAAB44282 Mouse,Mus musculus,Tetraspanin-6,Tm4sf6,Transmembrane 4 superfamily member 6,Tspan6,Tspan-6
EIAAB44237 Mouse,Mus musculus,Tetraspanin-12,Tm4sf12,Transmembrane 4 superfamily member 12,Tspan12,Tspan-12
EIAAB44280 A15 homolog,Homo sapiens,Human,Putative NF-kappa-B-activating protein 321,T245 protein,Tetraspanin TM4-D,Tetraspanin-6,TM4SF6,Transmembrane 4 superfamily member 6,TSPAN6,Tspan-6,UNQ767_PRO1560
EIAAB44246 D14Ertd226e,Mouse,Mus musculus,Tetraspanin-14,Tm4sf14,Transmembrane 4 superfamily member 14,Tspan14,Tspan-14
EIAAB44245 DC-TM4F2,Homo sapiens,Human,Tetraspanin-14,TM4SF14,Transmembrane 4 superfamily member 14,TSPAN14,Tspan-14
EIAAB44284 Homo sapiens,Human,Tetraspanin-8,TM4SF3,Transmembrane 4 superfamily member 3,TSPAN8,Tspan-8,Tumor-associated antigen CO-029
EIAAB44274 Homo sapiens,Human,NAG2,NAG-2,Novel antigen 2,Tetraspanin-4,TM4SF7,Transmembrane 4 superfamily member 7,TSPAN4,Tspan-4
U0751m CLIA Cell surface glycoprotein A15,Mouse,Mus musculus,Mxs1,PE31,TALLA homolog,Tetraspanin-7,Tm4sf2,Transmembrane 4 superfamily member 2,Tspan7,Tspan-7 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur