Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Thyroid hormone receptor alpha (Nuclear receptor subfamily 1 group A member 1) (c-erbA-1) (c-erbA-alpha)

 THA_RAT                 Reviewed;         492 AA.
P63059; P10685; P15827; P16416; P37241; Q63107; Q63195; Q63196;
Q99146;
13-SEP-2004, integrated into UniProtKB/Swiss-Prot.
13-SEP-2004, sequence version 1.
05-DEC-2018, entry version 137.
RecName: Full=Thyroid hormone receptor alpha;
AltName: Full=Nuclear receptor subfamily 1 group A member 1;
AltName: Full=c-erbA-1;
AltName: Full=c-erbA-alpha;
Name=Thra; Synonyms=C-erba-alpha, Nr1a1;
Rattus norvegicus (Rat).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Rattus.
NCBI_TaxID=10116;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS ALPHA-1 AND ALPHA-2).
PubMed=2841611; DOI=10.1038/334539a0;
Izumo S., Mahdavi V.;
"Thyroid hormone receptor alpha isoforms generated by alternative
splicing differentially activate myosin HC gene transcription.";
Nature 334:539-542(1988).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-2).
PubMed=3387247; DOI=10.1093/nar/16.12.5697;
Mitsuhashi T., Tennyson G., Nikodem V.;
"Nucleotide sequence of novel cDNAs generated by alternative splicing
of a rat thyroid hormone receptor gene transcript.";
Nucleic Acids Res. 16:5697-5697(1988).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-2).
PubMed=2903438; DOI=10.1210/mend-2-10-893;
Lazar M.A., Hodin R.A., Darling D.S., Chin W.W.;
"Identification of a rat c-erbA alpha-related protein which binds
deoxyribonucleic acid but does not bind thyroid hormone.";
Mol. Endocrinol. 2:893-901(1988).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA-1).
PubMed=3629259; DOI=10.1126/science.3629259;
Thompson C.C., Weinberger C., Lebo R., Evans R.M.;
"Identification of a novel thyroid hormone receptor expressed in the
mammalian central nervous system.";
Science 237:1610-1614(1987).
[5]
NUCLEOTIDE SEQUENCE [MRNA] OF 13-492 (ISOFORM ALPHA-1).
TISSUE=Heart;
Flink I.L., Bailey T., Bahl J., Morkin E.;
Submitted (AUG-1988) to the EMBL/GenBank/DDBJ databases.
[6]
INTERACTION WITH NCOA6.
PubMed=10866662; DOI=10.1128/MCB.20.14.5048-5063.2000;
Mahajan M.A., Samuels H.H.;
"A new family of nuclear receptor coregulators that integrates nuclear
receptor signaling through CBP.";
Mol. Cell. Biol. 20:5048-5063(2000).
[7]
X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) OF 152-410 (ISOFORM ALPHA-1).
PubMed=7501015; DOI=10.1038/378690a0;
Wagner R.L., Apriletti J.W., McGrath M.E., West B.L., Baxter J.D.,
Fletterick R.J.;
"A structural role for hormone in the thyroid hormone receptor.";
Nature 378:690-697(1995).
-!- FUNCTION: Nuclear hormone receptor that can act as a repressor or
activator of transcription. High affinity receptor for thyroid
hormones, including triiodothyronine and thyroxine.
-!- SUBUNIT: Binds DNA as a dimer; homodimer and heterodimer with
RXRB. Interacts with NCOA3 and NCOA6 coactivators, leading to a
strong increase of transcription of target genes. Probably
interacts with SFPQ. Interacts with C1D. Interacts with AKAP13.
Interacts with TP53INP2. Interacts with PER2 (By similarity).
{ECO:0000250}.
-!- SUBCELLULAR LOCATION: Nucleus.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=Alpha-2;
IsoId=P63059-1, P15827-1;
Sequence=Displayed;
Name=Alpha-1;
IsoId=P63059-2, P15827-2;
Sequence=VSP_011550;
-!- DOMAIN: Composed of three domains: a modulating N-terminal domain,
a DNA-binding domain and a C-terminal ligand-binding domain.
-!- SIMILARITY: Belongs to the nuclear hormone receptor family. NR1
subfamily. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; M31174; AAA41121.1; -; mRNA.
EMBL; M31177; AAA41122.1; -; mRNA.
EMBL; M18028; AAA42238.1; -; mRNA.
EMBL; X12744; CAA31237.1; -; mRNA.
PIR; A36752; TVRTAR.
PIR; I57696; I57696.
PIR; I67429; I67429.
PIR; S06410; S06410.
PIR; S06907; S06907.
PIR; S09178; S09178.
RefSeq; NP_001017960.1; NM_001017960.1. [P63059-2]
RefSeq; NP_112396.2; NM_031134.2.
UniGene; Rn.11307; -.
ProteinModelPortal; P63059; -.
SMR; P63059; -.
BioGrid; 249670; 3.
STRING; 10116.ENSRNOP00000012340; -.
BindingDB; P63059; -.
iPTMnet; P63059; -.
PhosphoSitePlus; P63059; -.
PaxDb; P63059; -.
PRIDE; P63059; -.
Ensembl; ENSRNOT00000087346; ENSRNOP00000072739; ENSRNOG00000009066. [P63059-2]
GeneID; 81812; -.
KEGG; rno:81812; -.
CTD; 7067; -.
RGD; 3857; Thra.
eggNOG; KOG3575; Eukaryota.
eggNOG; ENOG410XRZC; LUCA.
GeneTree; ENSGT00940000157917; -.
HOVERGEN; HBG005606; -.
InParanoid; P63059; -.
KO; K05547; -.
PhylomeDB; P63059; -.
Reactome; R-RNO-383280; Nuclear Receptor transcription pathway.
Reactome; R-RNO-4090294; SUMOylation of intracellular receptors.
PRO; PR:P63059; -.
Proteomes; UP000002494; Chromosome 10.
Bgee; ENSRNOG00000009066; Expressed in 10 organ(s), highest expression level in brain.
ExpressionAtlas; P63059; baseline and differential.
GO; GO:0005737; C:cytoplasm; IDA:RGD.
GO; GO:0005829; C:cytosol; IDA:RGD.
GO; GO:0005739; C:mitochondrion; IDA:RGD.
GO; GO:0005634; C:nucleus; IDA:RGD.
GO; GO:0090575; C:RNA polymerase II transcription factor complex; IBA:GO_Central.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; IBA:GO_Central.
GO; GO:0044213; F:intronic transcription regulatory region DNA binding; IDA:RGD.
GO; GO:0030374; F:nuclear receptor transcription coactivator activity; IBA:GO_Central.
GO; GO:0046983; F:protein dimerization activity; IDA:RGD.
GO; GO:0046982; F:protein heterodimerization activity; IDA:RGD.
GO; GO:0042803; F:protein homodimerization activity; IDA:RGD.
GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0043565; F:sequence-specific DNA binding; IDA:RGD.
GO; GO:0038023; F:signaling receptor activity; IBA:GO_Central.
GO; GO:0003727; F:single-stranded RNA binding; IDA:RGD.
GO; GO:0003707; F:steroid hormone receptor activity; IEA:InterPro.
GO; GO:0070324; F:thyroid hormone binding; ISS:UniProtKB.
GO; GO:0004887; F:thyroid hormone receptor activity; ISS:UniProtKB.
GO; GO:0003705; F:transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding; IDA:RGD.
GO; GO:0008134; F:transcription factor binding; IBA:GO_Central.
GO; GO:0000976; F:transcription regulatory region sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0008270; F:zinc ion binding; IEA:InterPro.
GO; GO:0030325; P:adrenal gland development; IEP:RGD.
GO; GO:0009887; P:animal organ morphogenesis; IBA:GO_Central.
GO; GO:0007420; P:brain development; IEP:RGD.
GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
GO; GO:0048565; P:digestive tract development; IEP:RGD.
GO; GO:0048568; P:embryonic organ development; IEP:RGD.
GO; GO:0009755; P:hormone-mediated signaling pathway; IBA:GO_Central.
GO; GO:0001822; P:kidney development; IEP:RGD.
GO; GO:0001889; P:liver development; IEP:RGD.
GO; GO:0030324; P:lung development; IEP:RGD.
GO; GO:0007275; P:multicellular organism development; IBA:GO_Central.
GO; GO:0043433; P:negative regulation of DNA-binding transcription factor activity; IDA:RGD.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; IBA:GO_Central.
GO; GO:0120162; P:positive regulation of cold-induced thermogenesis; ISS:YuBioLab.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:RGD.
GO; GO:0042493; P:response to drug; IEP:RGD.
GO; GO:0033993; P:response to lipid; IBA:GO_Central.
GO; GO:0031667; P:response to nutrient levels; IEP:RGD.
GO; GO:0030878; P:thyroid gland development; IBA:GO_Central.
GO; GO:0060509; P:type I pneumocyte differentiation; IBA:GO_Central.
Gene3D; 3.30.50.10; -; 1.
InterPro; IPR035500; NHR_like_dom_sf.
InterPro; IPR000536; Nucl_hrmn_rcpt_lig-bd.
InterPro; IPR001723; Nuclear_hrmn_rcpt.
InterPro; IPR001728; ThyrH_rcpt.
InterPro; IPR001628; Znf_hrmn_rcpt.
InterPro; IPR013088; Znf_NHR/GATA.
Pfam; PF00104; Hormone_recep; 1.
Pfam; PF00105; zf-C4; 1.
PRINTS; PR00398; STRDHORMONER.
PRINTS; PR00047; STROIDFINGER.
PRINTS; PR00546; THYROIDHORMR.
SMART; SM00430; HOLI; 1.
SMART; SM00399; ZnF_C4; 1.
SUPFAM; SSF48508; SSF48508; 1.
PROSITE; PS51843; NR_LBD; 1.
PROSITE; PS00031; NUCLEAR_REC_DBD_1; 1.
PROSITE; PS51030; NUCLEAR_REC_DBD_2; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; DNA-binding; Metal-binding;
Nucleus; Receptor; Reference proteome; Transcription;
Transcription regulation; Zinc; Zinc-finger.
CHAIN 1 492 Thyroid hormone receptor alpha.
/FTId=PRO_0000053427.
DOMAIN 163 407 NR LBD. {ECO:0000255|PROSITE-
ProRule:PRU01189}.
DNA_BIND 53 127 Nuclear receptor. {ECO:0000255|PROSITE-
ProRule:PRU00407}.
ZN_FING 53 73 NR C4-type. {ECO:0000255|PROSITE-
ProRule:PRU00407}.
ZN_FING 91 115 NR C4-type. {ECO:0000255|PROSITE-
ProRule:PRU00407}.
REGION 1 52 Modulating.
BINDING 228 228 Thyroid hormone. {ECO:0000250}.
BINDING 277 277 Thyroid hormone; via amide nitrogen.
{ECO:0000250}.
VAR_SEQ 371 492 EREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGP
QVRQLEQQFGEAGSLRGPVLQHQSPKSPQQRLLELLHRSGI
LHSRAVCGEDDSSEASSLSSSSSDEDTEVFEDLAGKAASP
-> VTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFEDQ
EV (in isoform Alpha-1).
{ECO:0000303|PubMed:2841611,
ECO:0000303|PubMed:3629259,
ECO:0000303|Ref.5}.
/FTId=VSP_011550.
CONFLICT 72 72 G -> C (in Ref. 3; AAA41121).
{ECO:0000305}.
CONFLICT 281 281 A -> T (in Ref. 4; AAA42238).
{ECO:0000305}.
CONFLICT 285 285 E -> K (in Ref. 1 and 4; AAA42238).
{ECO:0000305}.
CONFLICT 482 482 F -> C (in Ref. 3; AAA41121/AAA41122).
{ECO:0000305}.
SEQUENCE 492 AA; 55072 MW; 0B0411F51F614A01 CRC64;
MEQKPSKVEC GSDPEENSAR SPDGKRKRKN GQCPLKSSMS GYIPSYLDKD EQCVVCGDKA
TGYHYRCITC EGCKGFFRRT IQKNLHPTYS CKYDSCCVID KITRNQCQLC RFKKCIAVGM
AMDLVLDDSK RVAKRKLIEQ NRERRRKEEM IRSLQQRPEP TPEEWDLIHV ATEAHRSTNA
QGSHWKQRRK FLPDDIGQSP IVSMPDGDKV DLEAFSEFTK IITPAITRVV DFAKKLPMFS
ELPCEDQIIL LKGCCMEIMS LRAAVRYDPE SDTLTLSGEM AVKREQLKNG GLGVVSDAIF
ELGKSLSAFN LDDTEVALLQ AVLLMSTDRS GLLCVDKIEK SQEAYLLAFE HYVNHRKHNI
PHFWPKLLMK EREVQSSILY KGAAAEGRPG GSLGVHPEGQ QLLGMHVVQG PQVRQLEQQF
GEAGSLRGPV LQHQSPKSPQ QRLLELLHRS GILHSRAVCG EDDSSEASSL SSSSSDEDTE
VFEDLAGKAA SP


Related products :

Catalog number Product name Quantity
U1927m CLIA c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
E1927r ELISA c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
U1927r CLIA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927r ELISA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
U1927m CLIA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927r CLIA c-erbA-1,c-erbA-alpha,C-erba-alpha,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Rat,Rattus norvegicus,Thra,Thyroid hormone receptor alpha 96T
E1927m ELISA kit c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
E1927m ELISA c-erbA-1,c-erbA-alpha,C-erba-alpha,Mouse,Mus musculus,Nr1a1,Nuclear receptor subfamily 1 group A member 1,Thra,Thyroid hormone receptor alpha 96T
U1927h CLIA c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927h ELISA c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
E1927h ELISA kit c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
U1927h CLIA kit c-erbA-1,c-erbA-alpha,EAR7,EAR-7,ERBA1,Homo sapiens,Human,NR1A1,Nuclear receptor subfamily 1 group A member 1,THRA,THRA1,THRA2,Thyroid hormone receptor alpha,V-erbA-related protein 7 96T
18-783-75523 RABBIT ANTI THYROID HORMONE RECEPTOR ALPHA 1 - Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 0.05 mg
U1927p CLIA c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
18-783-77191 RABBIT ANTI THYROID HORMONE RECEPTOR ALPHA 1 - TRa; Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 1 ml
E1927p ELISA kit c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
U1927p CLIA kit c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
E1927p ELISA c-erbA-1,c-erbA-alpha,NR1A1,Nuclear receptor subfamily 1 group A member 1,Pig,Sus scrofa,THRA,Thyroid hormone receptor alpha 96T
18-783-77189 RABBIT ANTI THYROID HORMONE RECEPTOR BETA 1 - Nuclear receptor subfamily 1 group A member 1; C-erbA-alpha; c-erbA-1; EAR-7; EAR7 Polyclonal 1 ml
EIAAB42234 c-erbA-2,c-erbA-beta,Erba2,Mouse,Mus musculus,Nr1a2,Nuclear receptor subfamily 1 group A member 2,Thrb,Thyroid hormone receptor beta
EIAAB42233 c-erbA-2,c-erbA-beta,Erba2,Nr1a2,Nuclear receptor subfamily 1 group A member 2,Rat,Rattus norvegicus,Thrb,Thyroid hormone receptor beta
EIAAB42232 c-erbA-2,c-erbA-beta,ERBA2,Homo sapiens,Human,NR1A2,Nuclear receptor subfamily 1 group A member 2,THR1,THRB,Thyroid hormone receptor beta
EIAAB27773 EAR-1,Nr1d1,Nuclear receptor subfamily 1 group D member 1,Rat,Rattus norvegicus,Rev-erbA-alpha,V-erbA-related protein 1
EIAAB27776 Bos taurus,Bovine,EAR-1,NR1D1,Nuclear receptor subfamily 1 group D member 1,Rev-erbA-alpha,V-erbA-related protein 1
EIAAB27774 Ear1,EAR-1,Mouse,Mus musculus,Nr1d1,Nuclear receptor subfamily 1 group D member 1,Rev-erbA-alpha,V-erbA-related protein 1


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: +49 0241 40 08 90 86, +49 0241 95 78 94 78, +49 0241 40 08 90 86
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur