Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Titin (EC 2.7.11.1) (Connectin) (Rhabdomyosarcoma antigen MU-RMS-40.14)

 TITIN_HUMAN             Reviewed;       34350 AA.
Q8WZ42; A6NKB1; E7EQE6; E7ET18; K7ENY1; Q10465; Q10466; Q15598;
Q2XUS3; Q32Q60; Q4U1Z6; Q4ZG20; Q6NSG0; Q6PDB1; Q6PJP0; Q7KYM2;
Q7KYN4; Q7KYN5; Q7LDM3; Q7Z2X3; Q8TCG8; Q8WZ51; Q8WZ52; Q8WZ53;
Q8WZB3; Q92761; Q92762; Q9UD97; Q9UP84; Q9Y6L9;
13-JUN-2006, integrated into UniProtKB/Swiss-Prot.
18-APR-2012, sequence version 4.
25-OCT-2017, entry version 166.
RecName: Full=Titin;
EC=2.7.11.1;
AltName: Full=Connectin;
AltName: Full=Rhabdomyosarcoma antigen MU-RMS-40.14;
Name=TTN;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF
3336-12202 (ISOFORM 4), AND VARIANTS ILE-498; GLU-1201; MET-3261;
ASN-3419; SER-3491; GLU-12679; ILE-19762; ILE-20718; ASN-23807;
MET-24980 AND THR-27755.
TISSUE=Skeletal muscle;
PubMed=7569978; DOI=10.1126/science.270.5234.293;
Labeit S., Kolmerer B.;
"Titins, giant proteins in charge of muscle ultrastructure and
elasticity.";
Science 270:293-296(1995).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, AND VARIANTS
LEU-1295; GLN-1572; ILE-2610; ASN-2831; SER-3491; PRO-4215; PHE-4283
AND ARG-12383.
PubMed=10850961; DOI=10.1161/01.RES.86.11.1114;
Freiburg A., Trombitas K., Hell W., Cazorla O., Fougerousse F.,
Centner T., Kolmerer B., Witt C., Beckmann J.S., Gregorio C.C.,
Granzier H., Labeit S.;
"Series of exon-skipping events in the elastic spring region of titin
as the structural basis for myofibrillar elastic diversity.";
Circ. Res. 86:1114-1121(2000).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING, TISSUE
SPECIFICITY, INTERACTION WITH OBSCN, AND VARIANTS LEU-1295; GLN-1572;
ILE-2610; ASN-2831; SER-3491; PRO-4215 AND PHE-4283.
PubMed=11717165; DOI=10.1161/hh2301.100981;
Bang M.-L., Centner T., Fornoff F., Geach A.J., Gotthardt M.,
McNabb M., Witt C.C., Labeit D., Gregorio C.C., Granzier H.,
Labeit S.;
"The complete gene sequence of titin, expression of an unusual ~700
kDa titin isoform and its interaction with obscurin identify a novel
Z-line to I-band linking system.";
Circ. Res. 89:1065-1072(2001).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-626 AND 34071-34350
(ISOFORM 3).
TISSUE=Muscle, and Skeletal muscle;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 405-709 (ISOFORMS 1 AND 2).
TISSUE=Heart muscle;
PubMed=8937992;
Gautel M., Goulding D., Bullard B., Weber K., Furst D.O.;
"The central Z-disk region of titin is assembled from a novel repeat
in variable copy numbers.";
J. Cell Sci. 109:2747-2754(1996).
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 2023-2060, AND TISSUE SPECIFICITY.
TISSUE=Heart muscle;
PubMed=7819249; DOI=10.1021/bi00002a021;
Musco G., Tziatzos C., Schuck P., Pastore A.;
"Dissecting titin into its structural motifs: identification of an
alpha helix near the N-terminus.";
Biochemistry 34:553-561(1995).
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 3455-4473, AND VARIANTS PRO-4215
AND PHE-4283.
PubMed=10051295; DOI=10.1161/01.CIR.99.8.1022;
Siu B.L., Niimura H., Osborne J.A., Fatkin D., MacRae C., Solomon S.,
Benson D.W., Seidman J.G., Seidman C.E.;
"Familial dilated cardiomyopathy locus maps to chromosome 2q31.";
Circulation 99:1022-1026(1999).
[9]
NUCLEOTIDE SEQUENCE [MRNA] OF 9806-12017 (ISOFORM 5).
TISSUE=Heart ventricle;
PubMed=12785098; DOI=10.1023/A:1023410523184;
Greaser M.L., Berri M., Warren C.M., Mozdziak P.E.;
"Species variations in cDNA sequence and exon splicing patterns in the
extensible I-band region of cardiac titin: relation to passive
tension.";
J. Muscle Res. Cell Motil. 23:473-482(2002).
[10]
PROTEIN SEQUENCE OF 11773-11783; 17908-17931; 18656-18669;
26545-26553; 28758-28774 AND 32920-32928, AND IDENTIFICATION BY MASS
SPECTROMETRY.
TISSUE=Fetal brain cortex;
Lubec G., Chen W.-Q., Sun Y.;
Submitted (DEC-2008) to UniProtKB.
[11]
NUCLEOTIDE SEQUENCE [MRNA] OF 12947-13797.
TISSUE=Embryonic rhabdomyosarcoma;
Behrends U., Gotz C., Mautner J.;
"Serological identification of rhabdomyosarcoma antigens.";
Submitted (OCT-2005) to the EMBL/GenBank/DDBJ databases.
[12]
NUCLEOTIDE SEQUENCE OF 14257-14543.
PubMed=8351016; DOI=10.1212/WNL.43.8.1581;
Gautel M., Lakey A., Barlow D.P., Holmes Z., Scales S., Leonard K.,
Labeit S., Mygland A., Gilhus N.E., Aarli J.A.;
"Titin antibodies in myasthenia gravis: identification of a major
immunogenic region of titin.";
Neurology 43:1581-1585(1993).
[13]
NUCLEOTIDE SEQUENCE [MRNA] OF 21021-22120, AND NUCLEOTIDE SEQUENCE
[GENOMIC DNA] OF 23754-24284.
PubMed=1582406;
Labeit S., Gautel M., Lakey A., Trinick J.;
"Towards a molecular understanding of titin.";
EMBO J. 11:1711-1716(1992).
[14]
NUCLEOTIDE SEQUENCE [MRNA] OF 29701-34350, AND PHOSPHORYLATION.
PubMed=8404852;
Gautel M., Leonard K., Labeit S.;
"Phosphorylation of KSF motifs in the C-terminal region of titin in
differentiating myoblasts.";
EMBO J. 12:3827-3834(1993).
[15]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 33119-34350.
TISSUE=Skeletal muscle;
PubMed=17974005; DOI=10.1186/1471-2164-8-399;
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U.,
Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H.,
Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K.,
Ottenwaelder B., Poustka A., Wiemann S., Schupp I.;
"The full-ORF clone resource of the German cDNA consortium.";
BMC Genomics 8:399-399(2007).
[16]
INTERACTION WITH TCAP.
PubMed=9645487; DOI=10.1016/S0014-5793(98)00501-8;
Mues A., van der Ven P.F.M., Young P., Furst D.O., Gautel M.;
"Two immunoglobulin-like domains of the Z-disc portion of titin
interact in a conformation-dependent way with telethonin.";
FEBS Lett. 428:111-114(1998).
[17]
INTERACTION WITH NEB.
PubMed=12482578; DOI=10.1016/S0014-5793(02)03655-4;
Ma K., Wang K.;
"Interaction of nebulin SH3 domain with titin PEVK and myopalladin:
implications for the signaling and assembly role of titin and
nebulin.";
FEBS Lett. 532:273-278(2002).
[18]
INTERACTION WITH FHL2.
PubMed=12432079; DOI=10.1242/jcs.00181;
Lange S., Auerbach D., McLoughlin P., Perriard E., Schafer B.W.,
Perriard J.-C., Ehler E.;
"Subcellular targeting of metabolic enzymes to titin in heart muscle
may be mediated by DRAL/FHL-2.";
J. Cell Sci. 115:4925-4936(2002).
[19]
INTERACTION WITH ANK1.
PubMed=12444090; DOI=10.1074/jbc.M209012200;
Kontrogianni-Konstantopoulos A., Bloch R.J.;
"The hydrophilic domain of small ankyrin-1 interacts with the two N-
terminal immunoglobulin domains of titin.";
J. Biol. Chem. 278:3985-3991(2003).
[20]
INTERACTION WITH ANKRD1; ANKRD2; ANKRD23 AND CAPN3.
PubMed=14583192; DOI=10.1016/j.jmb.2003.09.012;
Miller M.K., Bang M.-L., Witt C.C., Labeit D., Trombitas C.,
Watanabe K., Granzier H., McElhinny A.S., Gregorio C.C., Labeit S.;
"The muscle ankyrin repeat proteins: CARP, ankrd2/Arpp and DARP as a
family of titin filament-based stress response molecules.";
J. Mol. Biol. 333:951-964(2003).
[21]
INTERACTION WITH CRYAB.
PubMed=14676215; DOI=10.1074/jbc.M307473200;
Bullard B., Ferguson C., Minajeva A., Leake M.C., Gautel M.,
Labeit D., Ding L., Labeit S., Horwitz J., Leonard K.R., Linke W.A.;
"Association of the chaperone alphaB-crystallin with titin in heart
muscle.";
J. Biol. Chem. 279:7917-7924(2004).
[22]
INTERACTION WITH TRIM63 AND TRIM55.
PubMed=15967462; DOI=10.1016/j.jmb.2005.05.021;
Witt S.H., Granzier H., Witt C.C., Labeit S.;
"MURF-1 and MURF-2 target a specific subset of myofibrillar proteins
redundantly: towards understanding MURF-dependent muscle
ubiquitination.";
J. Mol. Biol. 350:713-722(2005).
[23]
INTERACTION WITH LAMIN, AND SUBCELLULAR LOCATION.
PubMed=16410549; DOI=10.1242/jcs.02728;
Zastrow M.S., Flaherty D.B., Benian G.M., Wilson K.L.;
"Nuclear titin interacts with A- and B-type lamins in vitro and in
vivo.";
J. Cell Sci. 119:239-249(2006).
[24]
REVIEW.
PubMed=16537787; DOI=10.1152/ajpheart.00816.2005;
Hoshijima M.;
"Mechanical stress-strain sensors embedded in cardiac cytoskeleton: Z
disk, titin, and associated structures.";
Am. J. Physiol. 290:H1313-H1325(2006).
[25]
INTERACTION WITH CMYA5.
PubMed=20634290; DOI=10.1074/jbc.M110.108720;
Sarparanta J., Blandin G., Charton K., Vihola A., Marchand S.,
Milic A., Hackman P., Ehler E., Richard I., Udd B.;
"Interactions with M-band titin and calpain 3 link myospryn (CMYA5) to
tibial and limb-girdle muscular dystrophies.";
J. Biol. Chem. 285:30304-30315(2010).
[26]
STRUCTURE BY NMR OF 33483-33579.
PubMed=7613868; DOI=10.1016/S0969-2126(01)00170-8;
Pfuhl M., Pastore A.;
"Tertiary structure of an immunoglobulin-like domain from the giant
muscle protein titin: a new member of the I set.";
Structure 3:391-401(1995).
[27]
X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 32172-32489, FUNCTION, ENZYME
REGULATION, INTERACTION WITH CALM, PHOSPHORYLATION AT TYR-32341, AND
MUTAGENESIS OF LYS-32207 AND TYR-32341.
PubMed=9804419; DOI=10.1038/27603;
Mayans O., van der Ven P.F.M., Wilm M., Mues A., Young P., Furst D.O.,
Wilmanns M., Gautel M.;
"Structural basis for activation of the titin kinase domain during
myofibrillogenesis.";
Nature 395:863-869(1998).
[28]
STRUCTURE BY NMR OF 22283-22385.
PubMed=9782056; DOI=10.1016/S0969-2126(98)00129-4;
Goll C.M., Pastore A., Nilges M.;
"The three-dimensional structure of a type I module from titin: a
prototype of intracellular fibronectin type III domains.";
Structure 6:1291-1302(1998).
[29]
X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 2073-2171, AND DISULFIDE
BOND.
PubMed=11525170; DOI=10.1016/S0969-2126(01)00591-3;
Mayans O., Wuerges J., Canela S., Gautel M., Wilmanns M.;
"Structural evidence for a possible role of reversible disulphide
bridge formation in the elasticity of the muscle protein titin.";
Structure 9:331-340(2001).
[30]
X-RAY CRYSTALLOGRAPHY (2.44 ANGSTROMS) OF 1-196 IN COMPLEX WITH TCAP.
PubMed=16407954; DOI=10.1038/nature04343;
Zou P., Pinotsis N., Lange S., Song Y.-H., Popov A., Mavridis I.,
Mayans O.M., Gautel M., Wilmanns M.;
"Palindromic assembly of the giant muscle protein titin in the
sarcomeric Z-disk.";
Nature 439:229-233(2006).
[31]
VARIANT CMH9 LEU-740.
PubMed=10462489; DOI=10.1006/bbrc.1999.1221;
Satoh M., Takahashi M., Sakamoto T., Hiroe M., Marumo F., Kimura A.;
"Structural analysis of the titin gene in hypertrophic cardiomyopathy:
identification of a novel disease gene.";
Biochem. Biophys. Res. Commun. 262:411-417(1999).
[32]
INVOLVEMENT IN LGMD2J, AND VARIANT TMD PRO-34315.
PubMed=12145747; DOI=10.1086/342380;
Hackman P., Vihola A., Haravuori H., Marchand S., Sarparanta J.,
De Seze J., Labeit S., Witt C., Peltonen L., Richard I., Udd B.;
"Tibial muscular dystrophy is a titinopathy caused by mutations in
TTN, the gene encoding the giant skeletal-muscle protein titin.";
Am. J. Hum. Genet. 71:492-500(2002).
[33]
VARIANTS CMD1G MET-54; VAL-743; TYR-3799 AND ASN-4465, VARIANTS
CYS-328; GLN-4084 AND PRO-4215, AND CHARACTERIZATION OF VARIANTS CMD1G
MET-54 AND VAL-743.
PubMed=11846417; DOI=10.1006/bbrc.2002.6448;
Itoh-Satoh M., Hayashi T., Nishi H., Koga Y., Arimura T., Koyanagi T.,
Takahashi M., Hohda S., Ueda K., Nouchi T., Hiroe M., Marumo F.,
Imaizumi T., Yasunami M., Kimura A.;
"Titin mutations as the molecular basis for dilated cardiomyopathy.";
Biochem. Biophys. Res. Commun. 291:385-393(2002).
[34]
VARIANT CMD1G ARG-976.
PubMed=11788824; DOI=10.1038/ng815;
Gerull B., Gramlich M., Atherton J., McNabb M., Trombitas K.,
Sasse-Klaassen S., Seidman J.G., Seidman C., Granzier H., Labeit S.,
Frenneaux M., Thierfelder L.;
"Mutations of TTN, encoding the giant muscle filament titin, cause
familial dilated cardiomyopathy.";
Nat. Genet. 30:201-204(2002).
[35]
VARIANT TMD ASN-34306.
PubMed=12891679; DOI=10.1002/ana.10647;
Van den Bergh P.Y.K., Bouquiaux O., Verellen C., Marchand S.,
Richard I., Hackman P., Udd B.;
"Tibial muscular dystrophy in a Belgian family.";
Ann. Neurol. 54:248-251(2003).
[36]
VARIANT CMD1G GLN-32996.
PubMed=16465475; DOI=10.1007/s10974-005-9018-5;
Matsumoto Y., Hayashi T., Inagaki N., Takahashi M., Hiroi S.,
Nakamura T., Arimura T., Nakamura K., Ashizawa N., Yasunami M.,
Ohe T., Yano K., Kimura A.;
"Functional analysis of titin/connectin N2-B mutations found in
cardiomyopathy.";
J. Muscle Res. Cell Motil. 26:367-374(2005).
[37]
VARIANT HMERF TRP-279, CHARACTERIZATION OF VARIANT HMERF TRP-279, AND
INTERACTION WITH NBR1.
PubMed=15802564; DOI=10.1126/science.1110463;
Lange S., Xiang F., Yakovenko A., Vihola A., Hackman P., Rostkova E.,
Kristensen J., Brandmeier B., Franzen G., Hedberg B., Gunnarsson L.G.,
Hughes S.M., Marchand S., Sejersen T., Richard I., Edstroem L.,
Ehler E., Udd B., Gautel M.;
"The kinase domain of titin controls muscle gene expression and
protein turnover.";
Science 308:1599-1603(2005).
[38]
INVOLVEMENT IN EOMFC.
PubMed=17444505; DOI=10.1002/ana.21089;
Carmignac V., Salih M.A.M., Quijano-Roy S., Marchand S.,
Al Rayess M.M., Mukhtar M.M., Urtizberea J.A., Labeit S.,
Guicheney P., Leturcq F., Gautel M., Fardeau M., Campbell K.P.,
Richard I., Estournet B., Ferreiro A.;
"C-terminal titin deletions cause a novel early-onset myopathy with
fatal cardiomyopathy.";
Ann. Neurol. 61:340-351(2007).
[39]
VARIANTS [LARGE SCALE ANALYSIS] TYR-60; MET-115; CYS-328; THR-360;
ILE-498; MET-799; ILE-811; HIS-922; ASP-937; THR-1081; ARG-1137;
GLU-1201; ALA-1202; LEU-1295; ASP-1345; THR-1347; HIS-1350; LEU-1353;
VAL-1393; CYS-1416; PRO-1441; VAL-1544; GLN-1572; GLY-1658; GLN-1664;
ASP-1692; LEU-1744; GLY-1772; ILE-1907; HIS-1998; LEU-2107; THR-2118;
THR-2164; TYR-2240; SER-2392; PHE-2432; ILE-2610; MET-2771; PHE-2823;
ASN-2831; ILE-2930; ARG-3154; GLU-3191; LEU-3238; GLY-3250; MET-3261;
GLN-3367; LYS-3482; LYS-3570; VAL-3590; VAL-3762; PHE-3877; LEU-3965;
PRO-4215; TRP-4238; PHE-4283; THR-4291; ASP-4303; GLU-4427; GLU-12310;
ALA-12469; CYS-12642; LYS-12657; GLU-12679; PHE-12720; CYS-12798;
GLY-13049; LYS-13083; LEU-13096; ARG-13099; ALA-13297; MET-13399;
THR-13418; VAL-13428; THR-13430; LYS-13434; ASN-13469; ASN-13495;
SER-13785; HIS-13870; ILE-14109; GLN-14131; THR-14208; VAL-14728;
THR-14999; THR-15021; VAL-15520; ILE-15555; GLN-15620; ILE-15629;
CYS-15635; GLN-15700; PRO-15705; MET-15837; HIS-16058; ILE-16067;
THR-16090; HIS-16195; CYS-16409; PRO-16424; MET-16629; ARG-16877;
ASP-17060; VAL-17637; HIS-17838; ASN-17866; GLU-17906; ALA-18094;
SER-18109; THR-18164; LEU-18221; THR-18222; GLN-18726; ALA-18835;
LYS-18881; SER-18939; GLN-19000; GLN-19060; LYS-19091; SER-19224;
ILE-19367; LYS-19392; SER-19480; GLY-19495; HIS-19665; ILE-19762;
ARG-19947; MET-19956; GLN-19992; CYS-20057; LEU-20075; LYS-20179;
THR-20198; VAL-20198; HIS-20331; THR-20408; LYS-20564; ILE-20718;
PRO-20726; ASN-20892; ARG-20894; GLU-21125; SER-21403; CYS-21730;
GLN-21747; ARG-21851; ARG-21851; ARG-21925; HIS-21995; VAL-22045;
HIS-22149; ILE-22160; THR-22261; ASN-22306; HIS-22357; PRO-22408;
HIS-22537; LEU-22584; PRO-22646; ALA-22670; ASP-22770; THR-22801;
TRP-22823; GLN-22968; LEU-23074; PHE-23079; ASN-23282; TYR-23303;
CYS-23306; SER-23515; GLN-23551; ASN-23807; ASN-23872; ALA-23891;
HIS-23933; MET-23939; LEU-23952; GLY-24098; SER-24119; ILE-24133;
ALA-24159; ALA-24239; LYS-24265; THR-24584; THR-24781; HIS-24799;
HIS-24954; MET-24980; HIS-25659; THR-25679; ALA-25720; LYS-25821;
LYS-25859; LYS-25879; VAL-25923; ILE-26045; GLU-26059; VAL-26134;
CYS-26477; TYR-26843; ARG-27346; CYS-27652; VAL-27728; LEU-27754;
THR-27755; VAL-27929; LEU-28132; GLN-28168; HIS-28538; THR-28572;
THR-28948; VAL-28986; GLU-28993; VAL-28998; MET-29070; VAL-29090;
CYS-29419; PRO-29479; LEU-29880; GLU-29976; GLY-30042; CYS-30107;
PHE-30125; PRO-30211; THR-30412; SER-30617; ILE-30674; ILE-30809;
ILE-30818; LYS-30825; THR-30856; ASP-30887; SER-30887; HIS-30897;
HIS-30907; HIS-30946; PHE-31081; CYS-31107; GLY-31124; SER-31156;
THR-31246; HIS-31330; ARG-31690; GLN-31724; ILE-31725; SER-31732;
ILE-31886; CYS-32097; ASN-32171; ILE-32248; HIS-32281; HIS-32323;
TRP-32411; VAL-32558; VAL-32610; VAL-32637; ALA-32922; ARG-32943;
HIS-32953; LEU-33213; CYS-33242; MET-33387; ASP-33419; MET-33536;
GLN-33568; LYS-33616; LEU-33620; VAL-33886; THR-33899; PRO-33904;
ILE-33955 AND ALA-34115.
PubMed=17344846; DOI=10.1038/nature05610;
Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C.,
Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S.,
O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S.,
Bhamra G., Buck G., Choudhury B., Clements J., Cole J., Dicks E.,
Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J.,
Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K.,
Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T.,
West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P.,
Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E.,
DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E.,
Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T.,
Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.;
"Patterns of somatic mutation in human cancer genomes.";
Nature 446:153-158(2007).
[40]
VARIANTS VAL-16046 AND GLN-32742.
PubMed=23033978; DOI=10.1056/NEJMoa1206524;
de Ligt J., Willemsen M.H., van Bon B.W., Kleefstra T., Yntema H.G.,
Kroes T., Vulto-van Silfhout A.T., Koolen D.A., de Vries P.,
Gilissen C., del Rosario M., Hoischen A., Scheffer H., de Vries B.B.,
Brunner H.G., Veltman J.A., Vissers L.E.;
"Diagnostic exome sequencing in persons with severe intellectual
disability.";
N. Engl. J. Med. 367:1921-1929(2012).
[41]
VARIANTS PRO-2963 AND GLN-14750.
PubMed=25173926; DOI=10.1161/CIRCGENETICS.113.000486;
Girolami F., Iascone M., Tomberli B., Bardi S., Benelli M.,
Marseglia G., Pescucci C., Pezzoli L., Sana M.E., Basso C.,
Marziliano N., Merlini P.A., Fornaro A., Cecchi F., Torricelli F.,
Olivotto I.;
"Novel alpha-actinin 2 variant associated with familial hypertrophic
cardiomyopathy and juvenile atrial arrhythmias: a massively parallel
sequencing study.";
Circ. Cardiovasc. Genet. 7:741-750(2014).
-!- FUNCTION: Key component in the assembly and functioning of
vertebrate striated muscles. By providing connections at the level
of individual microfilaments, it contributes to the fine balance
of forces between the two halves of the sarcomere. The size and
extensibility of the cross-links are the main determinants of
sarcomere extensibility properties of muscle. In non-muscle cells,
seems to play a role in chromosome condensation and chromosome
segregation during mitosis. Might link the lamina network to
chromatin or nuclear actin, or both during interphase.
{ECO:0000269|PubMed:9804419}.
-!- CATALYTIC ACTIVITY: ATP + a protein = ADP + a phosphoprotein.
-!- COFACTOR:
Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
-!- ENZYME REGULATION: Full activation of the protein kinase domain
requires both phosphorylation of Tyr-32341, preventing it from
blocking the catalytic aspartate residue, and binding of Ca/CALM
to the C-terminal regulatory tail of the molecule which results in
ATP binding to the kinase. {ECO:0000269|PubMed:9804419}.
-!- SUBUNIT: Interacts with MYOM1, MYOM2, tropomyosin and myosin.
Interacts with actin, primarily via the PEVK domains and with MYPN
(By similarity). Interacts with FHL2, NEB, CRYAB, LMNA/lamin-A and
LMNB/lamin-B. Interacts with TCAP/telethonin and/or ANK1 isoform
Mu17/ank1.5, via the first two N-terminal immunoglobulin domains.
Interacts with TRIM63 and TRIM55, through several domains
including immunoglobulin domains 141 and 142. Interacts with
ANKRD1, ANKRD2 and ANKRD23, via the region between immunoglobulin
domains 77 and 78 and interacts with CAPN3, via immunoglobulin
domain 79. Interacts with NBR1 through the protein kinase domain.
Interacts with CALM/calmodulin. Isoform 6 interacts with OBSCN
isoform 3. Interacts with CMYA5. {ECO:0000250,
ECO:0000269|PubMed:11717165, ECO:0000269|PubMed:12432079,
ECO:0000269|PubMed:12444090, ECO:0000269|PubMed:12482578,
ECO:0000269|PubMed:14583192, ECO:0000269|PubMed:14676215,
ECO:0000269|PubMed:15802564, ECO:0000269|PubMed:15967462,
ECO:0000269|PubMed:16407954, ECO:0000269|PubMed:16410549,
ECO:0000269|PubMed:20634290, ECO:0000269|PubMed:9645487,
ECO:0000269|PubMed:9804419}.
-!- INTERACTION:
Self; NbExp=16; IntAct=EBI-681210, EBI-681210;
P12814:ACTN1; NbExp=2; IntAct=EBI-681210, EBI-351710;
P35609:ACTN2; NbExp=16; IntAct=EBI-681210, EBI-77797;
P62158:CALM3; NbExp=2; IntAct=EBI-681210, EBI-397435;
P20807:CAPN3; NbExp=4; IntAct=EBI-681210, EBI-5655000;
O75953:DNAJB5; NbExp=4; IntAct=EBI-681210, EBI-5655937;
O75923:DYSF; NbExp=17; IntAct=EBI-681210, EBI-2799016;
P06733:ENO1; NbExp=3; IntAct=EBI-681210, EBI-353877;
Q14324:MYBPC2; NbExp=14; IntAct=EBI-681210, EBI-5653200;
Q13203:MYBPH; NbExp=3; IntAct=EBI-681210, EBI-5655165;
P54296:MYOM2; NbExp=2; IntAct=EBI-681210, EBI-5357134;
P20929:NEB; NbExp=6; IntAct=EBI-681210, EBI-1049657;
Q5VST9:OBSCN; NbExp=15; IntAct=EBI-681210, EBI-941850;
O75147:OBSL1; NbExp=13; IntAct=EBI-681210, EBI-1223896;
Q96CV9:OPTN; NbExp=2; IntAct=EBI-681210, EBI-748974;
O15061:SYNM; NbExp=3; IntAct=EBI-681210, EBI-7843148;
O15273:TCAP; NbExp=9; IntAct=EBI-681210, EBI-954089;
Q969Q1:TRIM63; NbExp=3; IntAct=EBI-681210, EBI-5661333;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305|PubMed:16410549}.
Nucleus {ECO:0000269|PubMed:16410549}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=13;
Comment=A number of isoforms may be produced, ranging from 27000
to 33000 residues in different striated muscle tissues, the size
of the full-length protein may be up to 38138 residues.;
Name=1;
IsoId=Q8WZ42-1; Sequence=Displayed;
Note=No experimental confirmation available.;
Name=2;
IsoId=Q8WZ42-2; Sequence=VSP_019138;
Note=No experimental confirmation available.;
Name=3; Synonyms=Small cardiac N2-B;
IsoId=Q8WZ42-3; Sequence=VSP_019139, VSP_019145;
Name=4; Synonyms=Soleus;
IsoId=Q8WZ42-4; Sequence=VSP_019142, VSP_019151;
Note=No experimental confirmation available.;
Name=5;
IsoId=Q8WZ42-5; Sequence=VSP_019147, VSP_019148, VSP_019149,
VSP_019150, VSP_019152;
Note=No experimental confirmation available.;
Name=6; Synonyms=Small cardiac novex-3;
IsoId=Q8WZ42-6; Sequence=VSP_019143, VSP_019146;
Note=Ref.3 (CAD12457) sequence is in conflict in position:
3732:L->F. Ref.3 (CAD12457) sequence is in conflict in position:
5139:R->M. {ECO:0000305};
Name=7; Synonyms=Cardiac novex-2;
IsoId=Q8WZ42-7; Sequence=VSP_019141, VSP_019144;
Name=8; Synonyms=Cardiac novex-1;
IsoId=Q8WZ42-8; Sequence=VSP_019140;
Name=9;
IsoId=Q8WZ42-9; Sequence=VSP_019139, VSP_042903, VSP_019145;
Name=10;
IsoId=Q8WZ42-10; Sequence=VSP_019139, VSP_019140, VSP_019145;
Name=11;
IsoId=Q8WZ42-11; Sequence=VSP_019142;
Name=12;
IsoId=Q8WZ42-12; Sequence=VSP_045935, VSP_045929, VSP_045930,
VSP_045931, VSP_045932, VSP_045933,
VSP_045934;
Note=No experimental confirmation available.;
Name=13;
IsoId=Q8WZ42-13; Sequence=VSP_047142;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Isoforms 3, 7 and 8 are expressed in cardiac
muscle. Isoform 4 is expressed in vertebrate skeletal muscle.
Isoform 6 is expressed in skeletal muscle (at protein level).
{ECO:0000269|PubMed:11717165, ECO:0000269|PubMed:7819249}.
-!- DOMAIN: ZIS1 and ZIS5 regions contain multiple SPXR consensus
sites for ERK- and CDK-like protein kinases as well as multiple SP
motifs. ZIS1 could adopt a closed conformation which would block
the TCAP-binding site.
-!- DOMAIN: The PEVK region may serve as an entropic spring of a chain
of structural folds and may also be an interaction site to other
myofilament proteins to form interfilament connectivity in the
sarcomere.
-!- PTM: Autophosphorylated. {ECO:0000250}.
-!- DISEASE: Hereditary myopathy with early respiratory failure
(HMERF) [MIM:603689]: Autosomal dominant, adult-onset myopathy
with early respiratory muscle involvement.
{ECO:0000269|PubMed:15802564}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Cardiomyopathy, familial hypertrophic 9 (CMH9)
[MIM:613765]: A hereditary heart disorder characterized by
ventricular hypertrophy, which is usually asymmetric and often
involves the interventricular septum. The symptoms include
dyspnea, syncope, collapse, palpitations, and chest pain. They can
be readily provoked by exercise. The disorder has inter- and
intrafamilial variability ranging from benign to malignant forms
with high risk of cardiac failure and sudden cardiac death.
{ECO:0000269|PubMed:10462489}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Cardiomyopathy, dilated 1G (CMD1G) [MIM:604145]: A
disorder characterized by ventricular dilation and impaired
systolic function, resulting in congestive heart failure and
arrhythmia. Patients are at risk of premature death.
{ECO:0000269|PubMed:11788824, ECO:0000269|PubMed:11846417,
ECO:0000269|PubMed:16465475}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Tardive tibial muscular dystrophy (TMD) [MIM:600334]:
Autosomal dominant, late-onset distal myopathy. Muscle weakness
and atrophy are usually confined to the anterior compartment of
the lower leg, in particular the tibialis anterior muscle.
Clinical symptoms usually occur at age 35-45 years or much later.
{ECO:0000269|PubMed:12145747, ECO:0000269|PubMed:12891679}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- DISEASE: Limb-girdle muscular dystrophy 2J (LGMD2J) [MIM:608807]:
An autosomal recessive degenerative myopathy characterized by
progressive weakness of the pelvic and shoulder girdle muscles.
Severe disability is observed within 20 years of onset.
{ECO:0000269|PubMed:12145747}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: Early-onset myopathy with fatal cardiomyopathy (EOMFC)
[MIM:611705]: Early-onset myopathies are inherited muscle
disorders that manifest typically from birth or infancy with
hypotonia, muscle weakness, and delayed motor development. EOMFC
is a titinopathy that, in contrast with the previously described
examples, involves both heart and skeletal muscle, has a
congenital onset, and is purely recessive. This phenotype is due
to homozygous out-of-frame TTN deletions, which lead to a total
absence of titin's C-terminal end from striated muscles and to
secondary CAPN3 depletion. {ECO:0000269|PubMed:17444505}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- MISCELLANEOUS: In some isoforms, after the PEVK repeat region
there is a long PEVK duplicated region. On account of this region,
it has been very difficult to sequence the whole protein. The
length of this region (ranging from 183 to 2174 residues), may be
a key elastic element of titin.
-!- SIMILARITY: Belongs to the protein kinase superfamily. CAMK
Ser/Thr protein kinase family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH58824.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 553.; Evidence={ECO:0000305};
Sequence=AAH70170.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 627.; Evidence={ECO:0000305};
Sequence=CAA62188.1; Type=Frameshift; Positions=17036, 17043; Evidence={ECO:0000305};
Sequence=CAD12455.1; Type=Frameshift; Positions=17036, 17043; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Wikipedia; Note=Titin entry;
URL="https://en.wikipedia.org/wiki/Titin";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X90568; CAA62188.1; ALT_FRAME; mRNA.
EMBL; X90569; CAA62189.1; -; mRNA.
EMBL; AJ277892; CAD12455.1; ALT_FRAME; Genomic_DNA.
EMBL; AJ277893; CAD12456.1; -; Genomic_DNA.
EMBL; AJ277892; CAD12457.1; -; Genomic_DNA.
EMBL; AJ277892; CAD12458.1; -; Genomic_DNA.
EMBL; AJ277892; CAD12459.1; -; Genomic_DNA.
EMBL; AC009948; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC010680; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; FJ695199; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC023270; AAX88844.1; -; Genomic_DNA.
EMBL; BC013396; AAH13396.1; -; mRNA.
EMBL; BC058824; AAH58824.1; ALT_SEQ; mRNA.
EMBL; BC070170; AAH70170.1; ALT_SEQ; mRNA.
EMBL; BC107797; AAI07798.1; -; mRNA.
EMBL; X98114; CAA66795.1; -; mRNA.
EMBL; X98115; CAA66796.1; -; mRNA.
EMBL; X83270; CAA58243.1; -; mRNA.
EMBL; AF058332; AAD22603.1; -; Genomic_DNA.
EMBL; AF058332; AAD22604.1; -; Genomic_DNA.
EMBL; AF525413; AAP80791.1; -; mRNA.
EMBL; DQ248309; ABB55264.1; -; mRNA.
EMBL; X64698; CAA45939.1; -; mRNA.
EMBL; X64699; CAA45940.1; -; Genomic_DNA.
EMBL; X64697; CAA45938.1; -; mRNA.
EMBL; X69490; CAA49245.1; -; mRNA.
EMBL; AL713647; CAD28458.1; -; mRNA.
CCDS; CCDS33337.1; -. [Q8WZ42-6]
CCDS; CCDS54421.1; -. [Q8WZ42-3]
CCDS; CCDS54422.1; -. [Q8WZ42-9]
CCDS; CCDS54423.1; -. [Q8WZ42-10]
CCDS; CCDS54424.1; -. [Q8WZ42-11]
CCDS; CCDS59435.1; -. [Q8WZ42-12]
CCDS; CCDS74610.1; -. [Q8WZ42-1]
PIR; I38344; I38344.
PIR; I38346; I38346.
RefSeq; NP_001243779.1; NM_001256850.1. [Q8WZ42-1]
RefSeq; NP_003310.4; NM_003319.4. [Q8WZ42-3]
RefSeq; NP_596869.4; NM_133378.4. [Q8WZ42-11]
RefSeq; NP_596870.2; NM_133379.4. [Q8WZ42-6]
RefSeq; NP_597676.3; NM_133432.3. [Q8WZ42-10]
UniGene; Hs.134602; -.
PDB; 1BPV; NMR; -; A=22283-22385.
PDB; 1G1C; X-ray; 2.10 A; A/B=2073-2171.
PDB; 1NCT; NMR; -; A=33483-33579.
PDB; 1NCU; NMR; -; A=33483-33579.
PDB; 1TIT; NMR; -; A=12680-12765.
PDB; 1TIU; NMR; -; A=12680-12765.
PDB; 1TKI; X-ray; 2.00 A; A/B=32172-32492.
PDB; 1TNM; NMR; -; A=33489-33579.
PDB; 1TNN; NMR; -; A=33489-33579.
PDB; 1WAA; X-ray; 1.80 A; A/B/C/D/E/F=12677-12765.
PDB; 1YA5; X-ray; 2.44 A; A/B=1-196.
PDB; 2A38; X-ray; 2.00 A; A/B/C=1-194.
PDB; 2BK8; X-ray; 1.69 A; A=32497-32590.
PDB; 2F8V; X-ray; 2.75 A; A/B/C/D=1-196.
PDB; 2ILL; X-ray; 2.20 A; A=31854-32047.
PDB; 2J8H; X-ray; 1.99 A; A=31854-32047.
PDB; 2J8O; X-ray; 2.49 A; A/B=31854-32047.
PDB; 2NZI; X-ray; 2.90 A; A/B=31854-32155.
PDB; 2RQ8; NMR; -; A=12677-12765.
PDB; 2WP3; X-ray; 1.48 A; T=34252-34350.
PDB; 2WWK; X-ray; 1.70 A; T=34252-34350.
PDB; 2WWM; X-ray; 2.30 A; D/T=34252-34350.
PDB; 2Y9R; X-ray; 1.90 A; T=34252-34350.
PDB; 3B43; X-ray; 3.30 A; A=7945-8511.
PDB; 3KNB; X-ray; 1.40 A; A=34253-34350.
PDB; 3LCY; X-ray; 2.50 A; A/B/C/D=31456-31649.
PDB; 3LPW; X-ray; 1.65 A; A/B=22877-23070.
PDB; 3PUC; X-ray; 0.96 A; A=33774-33871.
PDB; 3Q5O; X-ray; 2.05 A; A/B=34253-34350.
PDB; 3QP3; X-ray; 2.00 A; A/B/C=33294-33395.
PDB; 4C4K; X-ray; 1.95 A; T=34252-34350.
PDB; 4JNW; X-ray; 2.06 A; A/B=32172-32492.
PDB; 4O00; X-ray; 1.85 A; A/B=14217-14319.
PDB; 4QEG; X-ray; 2.00 A; A=2880-2967.
PDB; 4UOW; X-ray; 3.30 A; 1/3/5/7/9/B/D/F/H/J/L/N/P/R/T/V/X/Z=7-99.
PDB; 5BS0; X-ray; 2.40 A; C=24337-24345.
PDB; 5JDD; X-ray; 1.53 A; A=2795-3053.
PDB; 5JDE; X-ray; 1.90 A; A/B=2795-3053.
PDB; 5JDJ; X-ray; 1.74 A; A/B/C/D/E/F/G/H/I/J/K/L/M/N/O/P=2880-2967.
PDB; 5JOE; X-ray; 2.00 A; A=9582-9671.
PDBsum; 1BPV; -.
PDBsum; 1G1C; -.
PDBsum; 1NCT; -.
PDBsum; 1NCU; -.
PDBsum; 1TIT; -.
PDBsum; 1TIU; -.
PDBsum; 1TKI; -.
PDBsum; 1TNM; -.
PDBsum; 1TNN; -.
PDBsum; 1WAA; -.
PDBsum; 1YA5; -.
PDBsum; 2A38; -.
PDBsum; 2BK8; -.
PDBsum; 2F8V; -.
PDBsum; 2ILL; -.
PDBsum; 2J8H; -.
PDBsum; 2J8O; -.
PDBsum; 2NZI; -.
PDBsum; 2RQ8; -.
PDBsum; 2WP3; -.
PDBsum; 2WWK; -.
PDBsum; 2WWM; -.
PDBsum; 2Y9R; -.
PDBsum; 3B43; -.
PDBsum; 3KNB; -.
PDBsum; 3LCY; -.
PDBsum; 3LPW; -.
PDBsum; 3PUC; -.
PDBsum; 3Q5O; -.
PDBsum; 3QP3; -.
PDBsum; 4C4K; -.
PDBsum; 4JNW; -.
PDBsum; 4O00; -.
PDBsum; 4QEG; -.
PDBsum; 4UOW; -.
PDBsum; 5BS0; -.
PDBsum; 5JDD; -.
PDBsum; 5JDE; -.
PDBsum; 5JDJ; -.
PDBsum; 5JOE; -.
DisProt; DP00072; -.
ProteinModelPortal; Q8WZ42; -.
SMR; Q8WZ42; -.
BioGrid; 113124; 58.
CORUM; Q8WZ42; -.
DIP; DIP-33449N; -.
IntAct; Q8WZ42; 87.
MINT; MINT-2881875; -.
STRING; 9606.ENSP00000343764; -.
iPTMnet; Q8WZ42; -.
PhosphoSitePlus; Q8WZ42; -.
SwissPalm; Q8WZ42; -.
BioMuta; TTN; -.
MaxQB; Q8WZ42; -.
PaxDb; Q8WZ42; -.
PeptideAtlas; Q8WZ42; -.
PRIDE; Q8WZ42; -.
Ensembl; ENST00000342992; ENSP00000343764; ENSG00000155657. [Q8WZ42-11]
Ensembl; ENST00000359218; ENSP00000352154; ENSG00000155657. [Q8WZ42-10]
Ensembl; ENST00000360870; ENSP00000354117; ENSG00000155657. [Q8WZ42-6]
Ensembl; ENST00000460472; ENSP00000434586; ENSG00000155657. [Q8WZ42-3]
Ensembl; ENST00000591111; ENSP00000465570; ENSG00000155657. [Q8WZ42-1]
Ensembl; ENST00000615779; ENSP00000483597; ENSG00000155657. [Q8WZ42-1]
GeneID; 7273; -.
KEGG; hsa:7273; -.
UCSC; uc002unb.4; human. [Q8WZ42-1]
CTD; 7273; -.
DisGeNET; 7273; -.
EuPathDB; HostDB:ENSG00000155657.24; -.
GeneCards; TTN; -.
GeneReviews; TTN; -.
H-InvDB; HIX0030529; -.
H-InvDB; HIX0161887; -.
HGNC; HGNC:12403; TTN.
HPA; CAB022682; -.
HPA; HPA007042; -.
MalaCards; TTN; -.
MIM; 188840; gene.
MIM; 600334; phenotype.
MIM; 603689; phenotype.
MIM; 604145; phenotype.
MIM; 608807; phenotype.
MIM; 611705; phenotype.
MIM; 613765; phenotype.
neXtProt; NX_Q8WZ42; -.
OpenTargets; ENSG00000155657; -.
Orphanet; 178148; Antenatal multiminicore disease with arthrogryposis multiplex congenita.
Orphanet; 169186; Autosomal recessive centronuclear myopathy.
Orphanet; 140922; Autosomal recessive limb-girdle muscular dystrophy type 2J.
Orphanet; 324604; Classic multiminicore myopathy.
Orphanet; 289377; Early-onset myopathy with fatal cardiomyopathy.
Orphanet; 293899; Familial isolated arrhythmogenic ventricular dysplasia, biventricular form.
Orphanet; 293888; Familial isolated arrhythmogenic ventricular dysplasia, left dominant form.
Orphanet; 293910; Familial isolated arrhythmogenic ventricular dysplasia, right dominant form.
Orphanet; 154; Familial isolated dilated cardiomyopathy.
Orphanet; 155; Familial isolated hypertrophic cardiomyopathy.
Orphanet; 178464; Hereditary proximal myopathy with early respiratory failure.
Orphanet; 609; Tibial muscular dystrophy.
PharmGKB; PA37067; -.
eggNOG; KOG0613; Eukaryota.
eggNOG; ENOG410XQFD; LUCA.
GeneTree; ENSGT00860000133679; -.
HOGENOM; HOG000136636; -.
HOVERGEN; HBG080473; -.
InParanoid; Q8WZ42; -.
KO; K12567; -.
OMA; VYEGDSC; -.
TreeFam; TF316477; -.
BRENDA; 2.7.11.1; 2681.
Reactome; R-HSA-114608; Platelet degranulation.
Reactome; R-HSA-390522; Striated Muscle Contraction.
SignaLink; Q8WZ42; -.
SIGNOR; Q8WZ42; -.
ChiTaRS; TTN; human.
EvolutionaryTrace; Q8WZ42; -.
GeneWiki; Titin; -.
GenomeRNAi; 7273; -.
PRO; PR:Q8WZ42; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000155657; -.
ExpressionAtlas; Q8WZ42; baseline and differential.
Genevisible; Q8WZ42; HS.
GO; GO:0000794; C:condensed nuclear chromosome; IDA:BHF-UCL.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0005576; C:extracellular region; TAS:Reactome.
GO; GO:0031674; C:I band; IDA:BHF-UCL.
GO; GO:0031430; C:M band; IDA:BHF-UCL.
GO; GO:0005859; C:muscle myosin complex; IBA:GO_Central.
GO; GO:0005865; C:striated muscle thin filament; IDA:BHF-UCL.
GO; GO:0030018; C:Z disc; IDA:BHF-UCL.
GO; GO:0051015; F:actin filament binding; IDA:BHF-UCL.
GO; GO:0042805; F:actinin binding; IDA:BHF-UCL.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0005509; F:calcium ion binding; IDA:BHF-UCL.
GO; GO:0005516; F:calmodulin binding; IPI:BHF-UCL.
GO; GO:0019899; F:enzyme binding; IPI:UniProtKB.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0051371; F:muscle alpha-actinin binding; IPI:BHF-UCL.
GO; GO:0002020; F:protease binding; IPI:UniProtKB.
GO; GO:0019901; F:protein kinase binding; IPI:BHF-UCL.
GO; GO:0043621; F:protein self-association; IDA:BHF-UCL.
GO; GO:0004674; F:protein serine/threonine kinase activity; IDA:UniProtKB.
GO; GO:0004713; F:protein tyrosine kinase activity; IDA:MGI.
GO; GO:0008307; F:structural constituent of muscle; IMP:BHF-UCL.
GO; GO:0097493; F:structural molecule activity conferring elasticity; TAS:BHF-UCL.
GO; GO:0031433; F:telethonin binding; IPI:BHF-UCL.
GO; GO:0060048; P:cardiac muscle contraction; IMP:BHF-UCL.
GO; GO:0048739; P:cardiac muscle fiber development; IMP:BHF-UCL.
GO; GO:0003300; P:cardiac muscle hypertrophy; IMP:BHF-UCL.
GO; GO:0055008; P:cardiac muscle tissue morphogenesis; IMP:BHF-UCL.
GO; GO:0055003; P:cardiac myofibril assembly; IMP:BHF-UCL.
GO; GO:0035995; P:detection of muscle stretch; IDA:MGI.
GO; GO:0007076; P:mitotic chromosome condensation; IEP:BHF-UCL.
GO; GO:0006936; P:muscle contraction; TAS:UniProtKB.
GO; GO:0030049; P:muscle filament sliding; TAS:Reactome.
GO; GO:0002576; P:platelet degranulation; TAS:Reactome.
GO; GO:0010628; P:positive regulation of gene expression; IMP:CAFA.
GO; GO:0050714; P:positive regulation of protein secretion; IMP:CAFA.
GO; GO:0010737; P:protein kinase A signaling; IMP:CAFA.
GO; GO:0050790; P:regulation of catalytic activity; IMP:BHF-UCL.
GO; GO:0045859; P:regulation of protein kinase activity; IMP:BHF-UCL.
GO; GO:0051592; P:response to calcium ion; IDA:BHF-UCL.
GO; GO:0045214; P:sarcomere organization; IMP:BHF-UCL.
GO; GO:0048769; P:sarcomerogenesis; IMP:BHF-UCL.
GO; GO:0030241; P:skeletal muscle myosin thick filament assembly; IMP:BHF-UCL.
GO; GO:0030240; P:skeletal muscle thin filament assembly; IMP:BHF-UCL.
GO; GO:0006941; P:striated muscle contraction; TAS:UniProtKB.
CDD; cd00063; FN3; 132.
Gene3D; 2.60.40.10; -; 193.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR013098; Ig_I-set.
InterPro; IPR003599; Ig_sub.
InterPro; IPR003598; Ig_sub2.
InterPro; IPR013106; Ig_V-set.
InterPro; IPR011009; Kinase-like_dom.
InterPro; IPR004168; PPAK_motif.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR015129; Titin_Z_rpt.
InterPro; IPR008266; Tyr_kinase_AS.
Pfam; PF00041; fn3; 132.
Pfam; PF07679; I-set; 162.
Pfam; PF00069; Pkinase; 1.
Pfam; PF02818; PPAK; 8.
Pfam; PF09042; Titin_Z; 7.
SMART; SM00060; FN3; 132.
SMART; SM00409; IG; 167.
SMART; SM00408; IGc2; 148.
SMART; SM00406; IGv; 23.
SUPFAM; SSF48726; SSF48726; 168.
SUPFAM; SSF49265; SSF49265; 83.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS50853; FN3; 132.
PROSITE; PS50835; IG_LIKE; 140.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; ATP-binding; Calcium;
Calmodulin-binding; Cardiomyopathy; Coiled coil; Complete proteome;
Cytoplasm; Direct protein sequencing; Disease mutation;
Disulfide bond; Immunoglobulin domain; Kinase;
Limb-girdle muscular dystrophy; Magnesium; Metal-binding;
Nucleotide-binding; Nucleus; Phosphoprotein; Polymorphism;
Reference proteome; Repeat; Serine/threonine-protein kinase;
Transferase.
CHAIN 1 34350 Titin.
/FTId=PRO_0000239311.
DOMAIN 6 96 Ig-like 1.
DOMAIN 104 192 Ig-like 2.
REPEAT 417 462 Z-repeat 1.
REPEAT 466 511 Z-repeat 2.
REPEAT 512 554 Z-repeat 3.
REPEAT 555 600 Z-repeat 4.
REPEAT 601 646 Z-repeat 5.
REPEAT 647 691 Z-repeat 6.
REPEAT 692 740 Z-repeat 7.
DOMAIN 943 1031 Ig-like 3.
DOMAIN 1082 1172 Ig-like 4.
DOMAIN 1291 1382 Ig-like 5.
DOMAIN 1457 1546 Ig-like 6.
DOMAIN 1556 1646 Ig-like 7.
DOMAIN 1703 1793 Ig-like 8.
DOMAIN 1841 1928 Ig-like 9.
DOMAIN 2078 2167 Ig-like 10.
DOMAIN 2171 2262 Ig-like 11.
DOMAIN 2264 2354 Ig-like 12.
DOMAIN 2353 2443 Ig-like 13.
DOMAIN 2430 2529 Ig-like 14.
DOMAIN 2620 2703 Ig-like 15.
DOMAIN 2880 2965 Ig-like 16.
DOMAIN 2968 3050 Ig-like 17.
DOMAIN 3058 3141 Ig-like 18.
DOMAIN 3239 3327 Ig-like 19.
DOMAIN 3344 3432 Ig-like 20.
DOMAIN 3503 3586 Ig-like 21.
DOMAIN 3621 3712 Ig-like 22.
DOMAIN 4289 4376 Ig-like 23.
DOMAIN 4383 4471 Ig-like 24.
DOMAIN 4478 4566 Ig-like 25.
DOMAIN 4571 4659 Ig-like 26.
DOMAIN 4664 4753 Ig-like 27.
DOMAIN 4758 4846 Ig-like 28.
DOMAIN 4851 4936 Ig-like 29.
DOMAIN 4943 5032 Ig-like 30.
DOMAIN 5040 5128 Ig-like 31.
DOMAIN 5133 5221 Ig-like 32.
DOMAIN 5225 5314 Ig-like 33.
DOMAIN 5320 5408 Ig-like 34.
DOMAIN 5413 5501 Ig-like 35.
DOMAIN 5505 5594 Ig-like 36.
DOMAIN 5602 5690 Ig-like 37.
DOMAIN 5695 5783 Ig-like 38.
DOMAIN 5788 5877 Ig-like 39.
DOMAIN 5882 5970 Ig-like 40.
DOMAIN 5975 6063 Ig-like 41.
DOMAIN 6067 6156 Ig-like 42.
DOMAIN 6164 6252 Ig-like 43.
DOMAIN 6257 6347 Ig-like 44.
DOMAIN 6350 6440 Ig-like 45.
DOMAIN 6444 6534 Ig-like 46.
DOMAIN 6537 6626 Ig-like 47.
DOMAIN 6630 6721 Ig-like 48.
DOMAIN 6727 6815 Ig-like 49.
DOMAIN 6820 6908 Ig-like 50.
DOMAIN 6912 7001 Ig-like 51.
DOMAIN 7005 7093 Ig-like 52.
DOMAIN 7102 7190 Ig-like 53.
DOMAIN 7198 7286 Ig-like 54.
DOMAIN 7291 7380 Ig-like 55.
DOMAIN 7385 7473 Ig-like 56.
DOMAIN 7478 7567 Ig-like 57.
DOMAIN 7571 7662 Ig-like 58.
DOMAIN 7668 7756 Ig-like 59.
DOMAIN 7761 7849 Ig-like 60.
DOMAIN 7853 7942 Ig-like 61.
DOMAIN 7946 8035 Ig-like 62.
DOMAIN 8042 8133 Ig-like 63.
DOMAIN 8138 8229 Ig-like 64.
DOMAIN 8232 8321 Ig-like 65.
DOMAIN 8326 8414 Ig-like 66.
DOMAIN 8419 8508 Ig-like 67.
DOMAIN 8512 8603 Ig-like 68.
DOMAIN 8609 8697 Ig-like 69.
DOMAIN 8702 8790 Ig-like 70.
DOMAIN 8794 8883 Ig-like 71.
DOMAIN 8888 8976 Ig-like 72.
DOMAIN 8984 9074 Ig-like 73.
DOMAIN 9079 9168 Ig-like 74.
DOMAIN 9176 9265 Ig-like 75.
DOMAIN 9272 9361 Ig-like 76.
DOMAIN 9366 9470 Ig-like 77.
DOMAIN 9660 9755 Ig-like 78.
DOMAIN 9760 9851 Ig-like 79.
REPEAT 10216 10242 PEVK 1.
REPEAT 10244 10270 PEVK 2.
REPEAT 10272 10298 PEVK 3.
REPEAT 10300 10326 PEVK 4.
REPEAT 10327 10353 PEVK 5.
REPEAT 10355 10381 PEVK 6.
REPEAT 10508 10534 PEVK 7.
REPEAT 10536 10562 PEVK 8.
REPEAT 10592 10618 PEVK 9.
REPEAT 10878 10904 PEVK 10.
REPEAT 10906 10930 PEVK 11.
REPEAT 10932 10958 PEVK 12.
REPEAT 10960 10986 PEVK 13.
REPEAT 10987 11014 PEVK 14.
REPEAT 11363 11396 PEVK 15.
REPEAT 11397 11421 PEVK 16.
REPEAT 11453 11479 PEVK 17.
REPEAT 11481 11507 PEVK 18.
REPEAT 11509 11535 PEVK 19.
REPEAT 11537 11563 PEVK 20.
REPEAT 11565 11591 PEVK 21.
REPEAT 11657 11683 PEVK 22.
REPEAT 11703 11729 PEVK 23.
REPEAT 11745 11771 PEVK 24.
REPEAT 11775 11801 PEVK 25.
REPEAT 11836 11862 PEVK 26.
REPEAT 11864 11890 PEVK 27.
REPEAT 11893 11919 PEVK 28.
REPEAT 11929 11955 PEVK 29.
REPEAT 11966 11992 PEVK 30.
REPEAT 11996 12022 PEVK 31.
DOMAIN 12041 12133 Ig-like 80.
DOMAIN 12138 12222 Ig-like 81.
DOMAIN 12233 12318 Ig-like 82.
DOMAIN 12499 12584 Ig-like 83.
DOMAIN 12590 12672 Ig-like 84.
DOMAIN 12766 12850 Ig-like 85.
DOMAIN 12945 13032 Ig-like 86.
DOMAIN 13120 13206 Ig-like 87.
DOMAIN 13210 13295 Ig-like 88.
DOMAIN 13299 13384 Ig-like 89.
DOMAIN 13388 13478 Ig-like 90.
DOMAIN 13479 13562 Ig-like 91.
DOMAIN 13565 13655 Ig-like 92.
DOMAIN 13659 13748 Ig-like 93.
DOMAIN 13749 13833 Ig-like 94.
DOMAIN 13927 14012 Ig-like 95.
DOMAIN 14019 14114 Fibronectin type-III 1.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14120 14215 Fibronectin type-III 2.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14221 14316 Fibronectin type-III 3.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14417 14513 Fibronectin type-III 4.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14517 14614 Fibronectin type-III 5.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14615 14708 Ig-like 96.
DOMAIN 14713 14806 Fibronectin type-III 6.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14812 14907 Fibronectin type-III 7.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 14913 15007 Fibronectin type-III 8.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15010 15107 Fibronectin type-III 9.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15113 15207 Fibronectin type-III 10.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15214 15310 Fibronectin type-III 11.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15314 15402 Ig-like 97.
DOMAIN 15409 15503 Fibronectin type-III 12.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15509 15604 Fibronectin type-III 13.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15608 15724 Ig-like 98.
DOMAIN 15731 15826 Fibronectin type-III 14.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15832 15926 Fibronectin type-III 15.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 15929 16025 Fibronectin type-III 16.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16029 16119 Ig-like 99.
DOMAIN 16126 16218 Fibronectin type-III 17.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16224 16318 Fibronectin type-III 18.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16322 16420 Ig-like 100.
DOMAIN 16427 16522 Fibronectin type-III 19.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16528 16628 Fibronectin type-III 20.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16634 16734 Fibronectin type-III 21.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16727 16834 Ig-like 101.
DOMAIN 16841 16934 Fibronectin type-III 22.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 16941 17041 Fibronectin type-III 23.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17044 17139 Ig-like 102.
DOMAIN 17147 17240 Fibronectin type-III 24.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17246 17345 Fibronectin type-III 25.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17348 17445 Fibronectin type-III 26.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17449 17536 Ig-like 103.
DOMAIN 17545 17640 Fibronectin type-III 27.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17646 17741 Fibronectin type-III 28.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17745 17834 Ig-like 104.
DOMAIN 17842 17935 Fibronectin type-III 29.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 17941 18036 Fibronectin type-III 30.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18042 18139 Fibronectin type-III 31.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18143 18228 Ig-like 105.
DOMAIN 18239 18333 Fibronectin type-III 32.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18339 18431 Fibronectin type-III 33.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18435 18526 Ig-like 106.
DOMAIN 18533 18632 Fibronectin type-III 34.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18633 18727 Fibronectin type-III 35.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18733 18829 Fibronectin type-III 36.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 18833 18924 Ig-like 107.
DOMAIN 18931 19025 Fibronectin type-III 37.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19030 19124 Fibronectin type-III 38.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19128 19219 Ig-like 108.
DOMAIN 19226 19321 Fibronectin type-III 39.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19325 19420 Fibronectin type-III 40.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19426 19527 Fibronectin type-III 41.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19531 19617 Ig-like 109.
DOMAIN 19628 19722 Fibronectin type-III 42.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19728 19823 Fibronectin type-III 43.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 19826 19914 Ig-like 110.
DOMAIN 19921 20017 Fibronectin type-III 44.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20018 20116 Fibronectin type-III 45.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20119 20217 Fibronectin type-III 46.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20220 20311 Ig-like 111.
DOMAIN 20318 20411 Fibronectin type-III 47.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20417 20512 Fibronectin type-III 48.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20518 20613 Fibronectin type-III 49.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20716 20813 Fibronectin type-III 50.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20814 20908 Fibronectin type-III 51.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 20893 20996 Ig-like 112.
DOMAIN 21006 21101 Fibronectin type-III 52.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21105 21200 Fibronectin type-III 53.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21203 21299 Fibronectin type-III 54.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21303 21395 Ig-like 113.
DOMAIN 21402 21495 Fibronectin type-III 55.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21501 21596 Fibronectin type-III 56.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21602 21697 Fibronectin type-III 57.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21701 21793 Ig-like 114.
DOMAIN 21797 21891 Fibronectin type-III 58.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21894 21986 Fibronectin type-III 59.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 21990 22083 Ig-like 115.
DOMAIN 22088 22182 Fibronectin type-III 60.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22188 22283 Fibronectin type-III 61.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22286 22382 Fibronectin type-III 62.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22386 22477 Ig-like 116.
DOMAIN 22484 22578 Fibronectin type-III 63.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22584 22679 Fibronectin type-III 64.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22685 22781 Fibronectin type-III 65.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22785 22874 Ig-like 117.
DOMAIN 22881 22976 Fibronectin type-III 66.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 22978 23071 Fibronectin type-III 67.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23075 23163 Ig-like 118.
DOMAIN 23170 23264 Fibronectin type-III 68.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23270 23364 Fibronectin type-III 69.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23368 23463 Fibronectin type-III 70.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23468 23555 Ig-like 119.
DOMAIN 23566 23660 Fibronectin type-III 71.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23666 23761 Fibronectin type-III 72.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23767 23863 Fibronectin type-III 73.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 23867 23954 Ig-like 120.
DOMAIN 23963 24057 Fibronectin type-III 74.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24060 24153 Fibronectin type-III 75.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24157 24241 Ig-like 121.
DOMAIN 24252 24346 Fibronectin type-III 76.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24352 24446 Fibronectin type-III 77.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24450 24546 Fibronectin type-III 78.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24550 24641 Ig-like 122.
DOMAIN 24648 24742 Fibronectin type-III 79.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24748 24843 Fibronectin type-III 80.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24849 24945 Fibronectin type-III 81.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 24949 25038 Ig-like 123.
DOMAIN 25045 25139 Fibronectin type-III 82.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25142 25235 Fibronectin type-III 83.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25239 25325 Ig-like 124.
DOMAIN 25335 25428 Fibronectin type-III 84.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25434 25529 Fibronectin type-III 85.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25532 25627 Fibronectin type-III 86.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25632 25722 Ig-like 125.
DOMAIN 25731 25825 Fibronectin type-III 87.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25831 25926 Fibronectin type-III 88.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 25932 26028 Fibronectin type-III 89.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26032 26121 Ig-like 126.
DOMAIN 26128 26222 Fibronectin type-III 90.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26225 26318 Fibronectin type-III 91.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26322 26410 Ig-like 127.
DOMAIN 26417 26510 Fibronectin type-III 92.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26516 26611 Fibronectin type-III 93.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26614 26710 Fibronectin type-III 94.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26714 26801 Ig-like 128.
DOMAIN 26812 26906 Fibronectin type-III 95.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 26912 27007 Fibronectin type-III 96.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27013 27107 Fibronectin type-III 97.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27101 27196 Ig-like 129.
DOMAIN 27205 27296 Fibronectin type-III 98.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27302 27392 Fibronectin type-III 99.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27499 27593 Fibronectin type-III 100.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27599 27694 Fibronectin type-III 101.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27697 27793 Fibronectin type-III 102.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27797 27888 Ig-like 130.
DOMAIN 27895 27989 Fibronectin type-III 103.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 27995 28090 Fibronectin type-III 104.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28096 28192 Fibronectin type-III 105.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28196 28286 Ig-like 131.
DOMAIN 28295 28389 Fibronectin type-III 106.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28392 28484 Fibronectin type-III 107.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28488 28577 Ig-like 132.
DOMAIN 28583 28680 Fibronectin type-III 108.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28686 28781 Fibronectin type-III 109.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28784 28879 Fibronectin type-III 110.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 28882 28974 Ig-like 133.
DOMAIN 28979 29071 Fibronectin type-III 111.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29081 29177 Fibronectin type-III 112.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29180 29278 Fibronectin type-III 113.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29282 29367 Ig-like 134.
DOMAIN 29378 29473 Fibronectin type-III 114.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29475 29568 Fibronectin type-III 115.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29568 29663 Ig-like 135.
DOMAIN 29670 29764 Fibronectin type-III 116.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29770 29865 Fibronectin type-III 117.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29868 29967 Fibronectin type-III 118.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 29971 30059 Ig-like 136.
DOMAIN 30070 30163 Fibronectin type-III 119.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30169 30265 Fibronectin type-III 120.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30271 30367 Fibronectin type-III 121.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30371 30460 Ig-like 137.
DOMAIN 30467 30561 Fibronectin type-III 122.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30564 30658 Fibronectin type-III 123.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30663 30754 Ig-like 138.
DOMAIN 30761 30855 Fibronectin type-III 124.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30861 30956 Fibronectin type-III 125.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 30962 31058 Fibronectin type-III 126.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 31061 31150 Ig-like 139.
DOMAIN 31158 31254 Fibronectin type-III 127.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 31258 31354 Fibronectin type-III 128.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 31360 31455 Fibronectin type-III 129.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 31460 31548 Ig-like 140.
DOMAIN 31653 31748 Fibronectin type-III 130.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 31754 31849 Fibronectin type-III 131.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 31855 31945 Ig-like 141.
DOMAIN 31955 32046 Ig-like 142.
DOMAIN 32051 32144 Fibronectin type-III 132.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
DOMAIN 32178 32432 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
DOMAIN 32496 32584 Ig-like 143.
DOMAIN 32617 32710 Ig-like 144.
DOMAIN 32722 32811 Ig-like 145.
DOMAIN 33301 33391 Ig-like 146.
DOMAIN 33488 33576 Ig-like 147.
DOMAIN 33645 33732 Ig-like 148.
DOMAIN 33779 33867 Ig-like 149.
DOMAIN 33963 34052 Ig-like 150.
DOMAIN 34061 34149 Ig-like 151.
DOMAIN 34256 34344 Ig-like 152.
NP_BIND 32184 32192 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
REGION 253 341 ZIS1.
REGION 1410 1440 ZIS5.
COILED 529 561 {ECO:0000255}.
COILED 2025 2052 {ECO:0000255}.
COILED 3462 3487 {ECO:0000255}.
COILED 9534 9577 {ECO:0000255}.
COMPBIAS 391 436 Ala-rich.
COMPBIAS 453 456 Poly-Thr.
COMPBIAS 9500 9503 Poly-Glu.
COMPBIAS 9861 9952 Pro-rich.
COMPBIAS 9974 11917 Glu-rich.
COMPBIAS 9974 10089 Glu-rich.
COMPBIAS 10102 10105 Poly-Pro.
COMPBIAS 10211 12032 Pro-rich.
COMPBIAS 33188 33193 Poly-Ser.
COMPBIAS 33197 33200 Poly-Arg.
COMPBIAS 34102 34244 Ser-rich.
ACT_SITE 32298 32298 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
BINDING 32207 32207 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
MOD_RES 263 263 Phosphoserine. {ECO:0000250}.
MOD_RES 265 265 Phosphoserine. {ECO:0000250}.
MOD_RES 267 267 Phosphothreonine. {ECO:0000250}.
MOD_RES 4065 4065 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 4068 4068 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 6920 6920 Phosphoserine. {ECO:0000250}.
MOD_RES 8490 8490 Phosphotyrosine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 9122 9122 Phosphoserine. {ECO:0000250}.
MOD_RES 9203 9203 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 9207 9207 Phosphothreonine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 11503 11503 Phosphoserine. {ECO:0000250}.
MOD_RES 12007 12007 Phosphothreonine. {ECO:0000250}.
MOD_RES 12009 12009 Phosphoserine. {ECO:0000250}.
MOD_RES 12022 12022 Phosphoserine. {ECO:0000250}.
MOD_RES 22525 22525 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 22534 22534 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 30443 30443 Phosphothreonine. {ECO:0000250}.
MOD_RES 32341 32341 Phosphotyrosine.
{ECO:0000269|PubMed:9804419}.
MOD_RES 33245 33245 Phosphoserine. {ECO:0000250}.
MOD_RES 33247 33247 Phosphoserine. {ECO:0000250}.
MOD_RES 33602 33602 Phosphoserine. {ECO:0000250}.
MOD_RES 33614 33614 Phosphoserine. {ECO:0000250}.
MOD_RES 33938 33938 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
MOD_RES 33942 33942 Phosphoserine.
{ECO:0000269|PubMed:8404852}.
DISULFID 964 1015 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 1724 1777 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 2109 2134 {ECO:0000255|PROSITE-ProRule:PRU00114,
ECO:0000269|PubMed:11525170}.
DISULFID 2196 2246 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 3259 3311 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 4404 4455 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 4499 4550 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 4592 4643 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 4686 4737 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 4779 4830 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 5061 5112 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 5248 5299 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 5623 5674 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 5810 5861 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 5903 5954 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 6185 6236 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 6372 6423 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 6465 6516 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 6748 6799 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7027 7078 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7123 7174 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7219 7270 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7313 7364 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7406 7457 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7689 7740 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 7968 8019 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 8064 8115 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 8160 8211 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 8254 8305 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 8347 8398 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 8630 8681 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 8909 8960 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 9005 9056 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 9101 9152 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 9294 9345 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 9693 9743 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 12067 12117 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 12611 12660 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 12966 13016 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 13233 13283 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 13322 13372 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 13411 13461 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 13771 13821 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 31481 31532 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 32516 32568 {ECO:0000255|PROSITE-ProRule:PRU00114}.
DISULFID 33664 33718 {ECO:0000255|PROSITE-ProRule:PRU00114}.
VAR_SEQ 555 646 Missing (in isoform 2).
{ECO:0000303|PubMed:8937992}.
/FTId=VSP_019138.
VAR_SEQ 556 601 Missing (in isoform 3, isoform 9 and
isoform 10).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:7569978}.
/FTId=VSP_019139.
VAR_SEQ 3434 3434 E -> EGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQ
PLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKD
VVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCA
ATLTVTPKVQALDRQSSGKDVRESAKSQAVADSSFTKEESK
ISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLC
HTASLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVKCG
DTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQ
FLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEG (in
isoform 12). {ECO:0000305}.
/FTId=VSP_045935.
VAR_SEQ 3434 3434 E -> EGFSKFEENTSNSQWHVSLSVSFKKEPLGQKPSFIQ
PLSSLRVHNGETVRFHARVSGIPKPEIQWFHNQQLILPTKD
VVFHFEESTGMALMLIVDAYSEHAGQYSCKAANSAGEATCA
ATLTVTPK (in isoform 8 and isoform 10).
{ECO:0000305}.
/FTId=VSP_019140.
VAR_SEQ 3434 3434 E -> EVQALDRQSSGKDVRESAKSQAVADSSFTKEESKIS
QKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQLCHT
ASLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVKCGDT
AQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGNIQFL
TICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEG (in
isoform 9). {ECO:0000305}.
/FTId=VSP_042903.
VAR_SEQ 3435 3645 APESILHERIEQEIEMEMKEFSSSFLSAEEEGLHSAELQLS
KINETLELLSESPVYPTKFDSEKEGTGPIFIKEVSNADISM
GDVATLSVTVIGIPKPKIQWFFNGVLLTPSADYKFVFDGDD
HSLIILFTKLEDEGEYTCMASNDYGKTICSAYLKINSKGEG
HKDTETESAVAKSLEKLGGPCPPHFLKELKPIRCAQGLPAI
FEYTVV -> VQALDRQSSGKDVRESTKSQAVADSSFTKEE
SKISQKEIKSFQGSSYEYEVQVFESVSQSSIHTAASVQDTQ
LCHTASLSQIAESTELSKECAKESTGEAPKIFLHLQDVTVK
CGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQSQNGN
IQFLTICNVQLVDQGLYSCIVHNDCGERTTSAVLSVEGAPE
SILHERIEQEIEMEMK (in isoform 7).
{ECO:0000305}.
/FTId=VSP_019141.
VAR_SEQ 3454 4380 Missing (in isoform 4 and isoform 11).
{ECO:0000303|PubMed:7569978}.
/FTId=VSP_019142.
VAR_SEQ 3455 5604 FSSSFLSAEEEGLHSAELQLSKINETLELLSESPVYPTKFD
SEKEGTGPIFIKEVSNADISMGDVATLSVTVIGIPKPKIQW
FFNGVLLTPSADYKFVFDGDDHSLIILFTKLEDEGEYTCMA
SNDYGKTICSAYLKINSKGEGHKDTETESAVAKSLEKLGGP
CPPHFLKELKPIRCAQGLPAIFEYTVVGEPAPTVTWFKENK
QLCTSVYYTIIHNPNGSGTFIVNDPQREDSGLYICKAENML
GESTCAAELLVLLEDTDMTDTPCKAKSTPEAPEDFPQTPLK
GPAVEALDSEQEIATFVKDTILKAALITEENQQLSYEHIAK
ANELSSQLPLGAQELQSILEQDKLTPESTREFLCINGSIHF
QPLKEPSPNLQLQIVQSQKTFSKEGILMPEEPETQAVLSDT
EKIFPSAMSIEQINSLTVEPLKTLLAEPEGNYPQSSIEPPM
HSYLTSVAEEVLSPKEKTVSDTNREQRVTLQKQEAQSALIL
SQSLAEGHVESLQSPDVMISQVNYEPLVPSEHSCTEGGKIL
IESANPLENAGQDSAVRIEEGKSLRFPLALEEKQVLLKEEH
SDNVVMPPDQIIESKREPVAIKKVQEVQGRDLLSKESLLSG
IPEEQRLNLKIQICRALQAAVASEQPGLFSEWLRNIEKVEV
EAVNITQEPRHIMCMYLVTSAKSVTEEVTIIIEDVDPQMAN
LKMELRDALCAIIYEEIDILTAEGPRIQQGAKTSLQEEMDS
FSGSQKVEPITEPEVESKYLISTEEVSYFNVQSRVKYLDAT
PVTKGVASAVVSDEKQDESLKPSEEKEESSSESGTEEVATV
KIQEAEGGLIKEDGPMIHTPLVDTVSEEGDIVHLTTSITNA
KEVNWYFENKLVPSDEKFKCLQDQNTYTLVIDKVNTEDHQG
EYVCEALNDSGKTATSAKLTVVKRAAPVIKRKIEPLEVALG
HLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYIS
SLEILRTQVVDCGEYTCKASNEYGSVSCTATLTVTEAYPPT
FLSRPKSLTTFVGKAAKFICTVTGTPVIETIWQKDGAALSP
SPNWRISDAENKHILELSNLTIQDRGVYSCKASNKFGADIC
QAELIIIDKPHFIKELEPVQSAINKKVHLECQVDEDRKVTV
TWSKDGQKLPPGKDYKICFEDKIATLEIPLAKLKDSGTYVC
TASNEAGSSSCSATVTVREPPSFVKKVDPSYLMLPGESARL
HCKLKGSPVIQVTWFKNNKELSESNTVRMYFVNSEAILDIT
DVKVEDSGSYSCEAVNDVGSDSCSTEIVIKEPPSFIKTLEP
ADIVRGTNALLQCEVSGTGPFEISWFKDKKQIRSSKKYRLF
SQKSLVCLEIFSFNSADVGEYECVVANEVGKCGCMATHLLK
EPPTFVKKVDDLIALGGQTVTLQAAVRGSEPISVTWMKGQE
VIREDGKIKMSFSNGVAVLIIPDVQISFGGKYTCLAENEAG
SQTSVGELIVKEPAKIIERAELIQVTAGDPATLEYTVAGTP
ELKPKWYKDGRPLVASKKYRISFKNNVAQLKFYSAELHDSG
QYTFEISNEVGSSSCETTFTVLDRDIAPFFTKPLRNVDSVV
NGTCRLDCKIAGSLPMRVSWFKDGKEIAASDRYRIAFVEGT
ASLEIIRVDMNDAGNFTCRATNSVGSKDSSGALIVQEPPSF
VTKPGSKDVLPGSAVCLKSTFQGSTPLTIRWFKGNKELVSG
GSCYITKEALESSLELYLVKTSDSGTYTCKVSNVAGGVECS
ANLFVKEPATFVEKLEPSQLLKKGDATQLACKVTGTPPIKI
TWFANDREIKESSKHRMSFVESTAVLRLTDVGIEDSGEYMC
EAQNEAGSDHCSSIVIVKESPYFTKEFKPIEVLKEYDVMLL
AEVAGTPPFEITWFKDNTILRSGRKYKTFIQDHLVSLQILK
FVAADAGEYQCRVTNEVGSSICSARVTLREPPSFIKKIEST
SSLRGGTAAFQATLKGSLPITVTWLKDSDEITEDDNIRMTF
ENNVASLYLSGIEVKHDGKYVCQAKNDAGIQRCSALLSVKE
PATITEEAVSIDVTQGDPATLQVKFSGTKEITAKWFKDGQE
LTLGSKYKISVTDTVSILKIISTEKKDSGEYTFEVQNDVGR
SSCKARINVLDLIIPPSF -> LFSEGESEHSERDTRDAFS
DSEDIDHKSMAAKRYASRISSTSSWPEYFKPSFTQKLTFKY
VLEGEPVVFTCRLIACPTPEMTWFHNNRPIPTGLRRIIKAE
SDLHHHSSSLEIKRVQDRDSGSYRLLAINSEGSAESTASLL
VIQKGQDEKYLEFLKRAERTHENVEALVERGEDRIKVDLRF
TGSPFNKKQDVEQKGMMRTIHFKTMSSAKKTDYMYDEEYLE
SKSDIRGWLNVGESFLDKETKVKLQRLREARKTLMEKKKLS
LLDTSSEISSRTLRSEASDKDILFSREDMKIRSMSDLAESY
KVDHSAESIVQNPHALSNQMDQNIESEELPTSFQTIVDEEI
FQTEIRMSQEALVKESLPKDHLYGEILVNENTQARGQLEEI
MANTTIGESSTYITNVCEKEEVYETPENVSQAITPHASESF
GTLVNVEESEEIASERIKKDDLRELQLSASTRIDEFKTEQK
EENMRFFENSFRKRPQRCPPSFLQEIESQEVYEGDSCNFVC
HFQGYPQPIVTWYNNDMPIPRNQNFIIHSLENYSILTLSSV
HHQNEGSITCVLFNQYGTVKTTSMLKVKAKQKHDVKAHKVP
VFHDYLDEEEELALVFDQAKGAHPSMSQEGQTNLHLLKTNP
PVPPSGDTELLSFPVEIQVTAATPIPEQDKESKEVFQTEEL
EPKAMPQDQVTQSPKHRFVFLSDITNEPPKMLQEMPKHARC
REGDSIILECLISGEPQPVVTWFQNGVLLKQNQKFQFEEVN
CSHQLYIKDVNSQDSGKYKCVAENNSGAVESVSDLTVEPVT
YRENSQFENIGEIYGKYSRDQQLQDQGESVRAHFYDYPAGP
FTPWTNVKEYSVRDYFQSLETIEQIDQKEQVRCIPSREKIP
RFVHGASRTIKISKPIRAEFIQCQAEGKERHVSEKSKLHQA
EGTVYPFVDDFSDVTIKKEIRNNFGKLGRSEKENVQECAQS
DYLPNIHSERISDSYNTKDSSAIVYEESLGEEIHYPGKKVK
HRIIEFEKLHVEKGVLEKRPTRTSIVNPPQKKIDDKAFSLK
QRESRSSNLNANMYQAEKMSPNTESDSSNIAINLKLLSSQT
HKEFDAQEREQQEKISLIDKPAISKRAEHESPITFDLKQFH
TQIKHTDVKFQELDSGQPEEAYFKIQHPADTENIVFDLKQM
YSHIGDPALEFQGQETREQQEIHYKEKIPSPETLQPDTHNI
SKSVQNNVFASQEISSSQELSNRTMVEKSSIDENSISLEKE
VRHVQEQNLDILKTDLSLKSFSEEIYSESCALLPTSSADIE
ETDLSEKSCPLENGGRSSISHLKKAASEEKPLGVGEMEEEC
TLEPELAAFPKQDGGTQEYTDATLEDHRGDVQEADTLHRQL
SLSQCFPLLMTEEQQNPGEQISTNIHASGEEKCYEEVQVQN
EASFSTLEGEMIETSFSQNIPKLDEAHTTEAAESETSLTQY
LLAAGKREVPETKDTRDQAKLVQSESITSMEVEEVTFNTVY
EYYNQKQESLGRPLSPESDISIGVGSTTSEEISELDQFYTP
PSSVEYFESPKSPDLYFNPSDITKQSSIHSGGETVERYSTP
LGEVAERYSTPSEGEVGERYSTPPGETLERYSTPPGETLER
YSTPPGETLERYSTPPGETLERYSTPPGETLERYSTPPGEA
LERYSIPTGGPNPTGTFKTYPSKIEREDGTPNEHFYTPTEE
RGSAYEIWRSDSFGTPNEAIEPKDNEMPPSFIEPLTKRKVY
ENTTLGFIVEVEGLPVPGVKWYRNKSLLEPDERIKMERVGN
VCSLEISNIQKGEGGEYMCHAVNIIGEAKSFANVDIMPQEE
RVVALPPPVTHQHVMEFDLEHTTSSRTPSPQEIVLEVELSE
KDVKEFEKQVKIVTVPEFTPDHKSMIVSLDVLPFNFVDPNM
DSREGEDKELKIDLEVFEMPPRFIMPICDFKIPENSDAVFK
CSVIGIPTPEVKWYKEYMCIEPDNIKYVISEEKGSHTLKIR
NVCLSDSATYRCRAVNCVGEAICRGFLTMGDSEIFAVIAKK
SKVTLSSLMEELVLKSNYTDSFFEFQVVEGPPRFIKGISDC
YAPIGTAAYFQCLVRGSPRPTVYWYKDGKLVQGRRFTVEES
GTGFHNLFITSLVKSDEGEYRCVATNKSGMAESFAALTLT
(in isoform 6). {ECO:0000305}.
/FTId=VSP_019143.
VAR_SEQ 3646 4380 Missing (in isoform 7). {ECO:0000305}.
/FTId=VSP_019144.
VAR_SEQ 4474 11851 Missing (in isoform 3, isoform 9 and
isoform 10).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:7569978}.
/FTId=VSP_019145.
VAR_SEQ 5605 34350 Missing (in isoform 6). {ECO:0000305}.
/FTId=VSP_019146.
VAR_SEQ 10382 10645 Missing (in isoform 5).
{ECO:0000303|PubMed:12785098}.
/FTId=VSP_019147.
VAR_SEQ 10742 10931 Missing (in isoform 5).
{ECO:0000303|PubMed:12785098}.
/FTId=VSP_019148.
VAR_SEQ 11015 11163 Missing (in isoform 5).
{ECO:0000303|PubMed:12785098}.
/FTId=VSP_019149.
VAR_SEQ 11117 11117 I -> VPKKPVPEKKVPVPAPKKVEPPPPPKVPEI (in
isoform 12). {ECO:0000305}.
/FTId=VSP_045929.
VAR_SEQ 11133 11133 E -> EAPPAKVSVVPKKPEPEKKVPPPGLKKAV (in
isoform 12). {ECO:0000305}.
/FTId=VSP_045930.
VAR_SEQ 11223 11852 Missing (in isoform 5).
{ECO:0000303|PubMed:12785098}.
/FTId=VSP_019150.
VAR_SEQ 11421 11421 K -> KAPEVPKKIVPEEKVREAVLKKPEVPPAKVPGMPKK
SVQEEKSPIVISEDTEMYIYEASEEAVLEEKVLVTQPQKTK
PKLAKVPEPPKKVVPEDKIYVTIPKKRETPATKEPDTTRGI
FPEVEPPEAIPEIPEHPPTEEFEVFKEVIPEGETPIVKRRK
TPSPTVPESPREIVPVKETPMAAPLEIEIPPTKAPEAMKEV
VPEMKIFEDVPEEPETPRMKTPEAPQEIIPAKTVPSKKREP
PSVKVPEALQEIVPEKKTLVVPLRKPEVLPDEVPEALREVV
PEKKVHPPQRAEVVPVKVHEAPKEIIPEKKVSVVPPKKPEV
PPVKVPEASKEVIREEKVPLAPPKEPEVPPVKVPEPPKEVV
PEKKAPVAPPKEPEVPPVKVPEAPKEVVPEKKVPVPPPKKP
EVPPTKVPEVPKAAVPEKKLPEAIPPKPESPPPE (in
isoform 12). {ECO:0000305}.
/FTId=VSP_045931.
VAR_SEQ 11450 11450 P -> PKVPEAPKEVVLEKKASVAVPKKPEAPRAKVPEAAQ
EVVPEKKIPKAPIKKPEAPAVTVPEVPQEATEKEIPVAPPK
KPEAPIVPVPEAQEVVPEKKVPKAPPTKPEAPPATVPEVPQ
EIVPEKKTLVLPKKPEVPPVTVPEAPKEVVLEKKVPSAPPK
KPEVPPV (in isoform 12). {ECO:0000305}.
/FTId=VSP_045932.
VAR_SEQ 11507 11507 E -> EVPEVLPPKEVVPEKKVPVPPAKKPEAPPPKVPEAP
KEVVLEKKASVAVPKKPEAPRAKVPEAAQEVVPEKKIPKAP
IKKPEAPAVTVPEVPQEAAEKEIPVAPPKKPEAPIVPVPEA
QEVVPEKKVPKAPPTKPEAPPATVPEVPQEIVPEKKTLVLP
KKPEVPPVTVPEAPKEVVLEKKVPSTPPKKPEVPPVKVPEA
PKEVVPEKKVPVPPPKKPEVPPTKVPEVPKAAVPEKKVPEA
IPPKPESPPPEVPEVLPPKEVVPEKKVPVPPAKKPEAPPPK
VPEAPKEVVLEKKVSVAVPKKPEAPRAKVPEAAQEVVPEKK
IPKAPIKKPEAPAVTVPEVPQEAAEKEIPVAPPKKPEAPIV
PVPEAQEVVPEKKVPKAPPTKPEAPPATVPEVPQEIVPEKK
TLVLPKKPEVPPVTVPEAPKEVVLEKKVPLAPPKKPEVPPV
KVPEAPKEVVPEKKVPVTPPKKPEVPPVKVPEAPIEVVPEK
KMPLAPPKKPEVPPVKVPEAPKEVVPEKKVPSAPPKKPEVP
PVK (in isoform 12). {ECO:0000305}.
/FTId=VSP_045933.
VAR_SEQ 11507 11507 E -> EVFEEPEESPSAPPKKPEVPPVR (in isoform
4). {ECO:0000303|PubMed:7569978}.
/FTId=VSP_019151.
VAR_SEQ 11790 11790 P -> PKEPEMPKKVVPVKKVPTVKKPETPAAKVPEVPKKL
VPVKKEPVPVTKKPEVLPEKVPKVPEKIIPEKEVSVPIPAE
PEVPPAEVEETPEEIIYEEKASITIGRKETPPVEEREIEKY
IKPEEPEPEPQPEEIPV (in isoform 13).
{ECO:0000305}.
/FTId=VSP_047142.
VAR_SEQ 11793 11793 P -> PEMPKKVVPVKKVPTVKKPETPAAKVPEVPKKLVPV
KKEPVPVTKKPEVLPEKVPKVPEKIIPEKEVSVPIPAEPEV
PPAEVEETPEEIIYEEKASITIGRKETPPVEEREIEKYIKP
EEPEPEPQPEEIPVKEP (in isoform 12).
{ECO:0000305}.
/FTId=VSP_045934.
VAR_SEQ 11985 12201 Missing (in isoform 5).
{ECO:0000303|PubMed:12785098}.
/FTId=VSP_019152.
VARIANT 54 54 V -> M (in CMD1G; affects interaction
with TCAP/telethonin; dbSNP:rs139517732).
{ECO:0000269|PubMed:11846417}.
/FTId=VAR_026685.
VARIANT 60 60 D -> Y (in dbSNP:rs35683768).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040078.
VARIANT 115 115 V -> M (in a metastatic melanoma sample;
somatic mutation; dbSNP:rs564777385).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040079.
VARIANT 279 279 R -> W (in HMERF; disrupts NBR1-binding;
dbSNP:rs138060032).
{ECO:0000269|PubMed:15802564}.
/FTId=VAR_026634.
VARIANT 328 328 R -> C (in dbSNP:rs16866538).
{ECO:0000269|PubMed:11846417,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_026686.
VARIANT 360 360 R -> T (in dbSNP:rs56128843).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040080.
VARIANT 498 498 V -> I (in dbSNP:rs72647851).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040081.
VARIANT 740 740 R -> L (in CMH9; dbSNP:rs28933405).
{ECO:0000269|PubMed:10462489}.
/FTId=VAR_026687.
VARIANT 743 743 A -> V (in CMD1G; affects interaction
with TCAP/telethonin; dbSNP:rs267607157).
{ECO:0000269|PubMed:11846417}.
/FTId=VAR_026688.
VARIANT 799 799 T -> M (in a colorectal adenocarcinoma
sample; somatic mutation;
dbSNP:rs149061352).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040082.
VARIANT 811 811 T -> I (in dbSNP:rs35813871).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040083.
VARIANT 922 922 R -> H (in dbSNP:rs56046320).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040084.
VARIANT 937 937 E -> D (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040085.
VARIANT 976 976 W -> R (in CMD1G; dbSNP:rs267607155).
{ECO:0000269|PubMed:11788824}.
/FTId=VAR_026689.
VARIANT 1081 1081 A -> T (in dbSNP:rs55914517).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040086.
VARIANT 1137 1137 G -> R (in dbSNP:rs72647870).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040087.
VARIANT 1201 1201 K -> E (in dbSNP:rs10497520).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040088.
VARIANT 1202 1202 V -> A (in dbSNP:rs150667217).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040089.
VARIANT 1249 1249 S -> L (in dbSNP:rs1552280).
/FTId=VAR_056081.
VARIANT 1295 1295 S -> L (in dbSNP:rs1552280).
{ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_040090.
VARIANT 1345 1345 G -> D (in dbSNP:rs36021856).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040091.
VARIANT 1347 1347 A -> T (in a metastatic melanoma sample;
somatic mutation; dbSNP:rs267599092).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040092.
VARIANT 1350 1350 R -> H (in a gastric adenocarcinoma
sample; somatic mutation;
dbSNP:rs539470256).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040093.
VARIANT 1353 1353 V -> L (in dbSNP:rs36062108).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040094.
VARIANT 1393 1393 I -> V (in dbSNP:rs16866531).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040095.
VARIANT 1416 1416 R -> C (in dbSNP:rs72647875).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040096.
VARIANT 1441 1441 R -> P (in dbSNP:rs72647876).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040097.
VARIANT 1544 1544 I -> V (in dbSNP:rs72647877).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040098.
VARIANT 1572 1572 R -> Q (in dbSNP:rs12476289).
{ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_040099.
VARIANT 1658 1658 R -> G (in dbSNP:rs56270960).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040100.
VARIANT 1664 1664 R -> Q (in an ovarian mucinous carcinoma
sample; somatic mutation;
dbSNP:rs375029799).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040101.
VARIANT 1692 1692 G -> D (in a lung squamous cell carcinoma
sample; somatic mutation;
dbSNP:rs370004591).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040102.
VARIANT 1744 1744 P -> L (in dbSNP:rs75686037).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040103.
VARIANT 1772 1772 S -> G (in dbSNP:rs150725992).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040104.
VARIANT 1907 1907 T -> I (in a colorectal adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040105.
VARIANT 1998 1998 R -> H (in dbSNP:rs144135510).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040106.
VARIANT 2107 2107 P -> L (in a colorectal adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040107.
VARIANT 2118 2118 I -> T (in dbSNP:rs56404770).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040108.
VARIANT 2164 2164 A -> T (in dbSNP:rs56285559).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040109.
VARIANT 2240 2240 D -> Y. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040110.
VARIANT 2392 2392 G -> S (in dbSNP:rs4894048).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040111.
VARIANT 2432 2432 L -> F (in a lung neuroendocrine
carcinoma sample; somatic mutation;
dbSNP:rs571572592).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040112.
VARIANT 2610 2610 M -> I (in dbSNP:rs56142888).
{ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_040113.
VARIANT 2771 2771 I -> M (in a breast infiltrating ductal
carcinoma sample; somatic mutation;
dbSNP:rs576644663).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040114.
VARIANT 2823 2823 V -> F (in dbSNP:rs33917087).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040115.
VARIANT 2831 2831 S -> N (in dbSNP:rs2306636).
{ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_040116.
VARIANT 2930 2930 V -> I (in dbSNP:rs56373393).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040117.
VARIANT 2963 2963 T -> P (in dbSNP:rs200875815).
{ECO:0000269|PubMed:25173926}.
/FTId=VAR_074293.
VARIANT 3026 3026 N -> I (in dbSNP:rs11900987).
/FTId=VAR_056082.
VARIANT 3154 3154 K -> R (in dbSNP:rs4893853).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040118.
VARIANT 3191 3191 Q -> E (in dbSNP:rs33997263).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040119.
VARIANT 3238 3238 P -> L (in a bladder carcinoma sample;
somatic mutation; dbSNP:rs397517792).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040120.
VARIANT 3250 3250 V -> G (in dbSNP:rs55634230).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040121.
VARIANT 3261 3261 V -> M (in dbSNP:rs2291311).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040122.
VARIANT 3367 3367 R -> Q (in dbSNP:rs34819099).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040123.
VARIANT 3419 3419 S -> N (in dbSNP:rs2291310).
{ECO:0000269|PubMed:7569978}.
/FTId=VAR_056083.
VARIANT 3482 3482 E -> K (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040124.
VARIANT 3491 3491 P -> S (in dbSNP:rs2627037).
{ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040125.
VARIANT 3570 3570 E -> K (in a breast pleomorphic lobular
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040126.
VARIANT 3590 3590 L -> V (in dbSNP:rs55853696).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040127.
VARIANT 3637 3637 P -> S (in dbSNP:rs2627037).
/FTId=VAR_056084.
VARIANT 3762 3762 I -> V (in dbSNP:rs34070843).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040128.
VARIANT 3799 3799 S -> Y (in CMD1G).
{ECO:0000269|PubMed:11846417}.
/FTId=VAR_026690.
VARIANT 3877 3877 I -> F (in dbSNP:rs34618570).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040129.
VARIANT 3965 3965 I -> L (in dbSNP:rs56244420).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040130.
VARIANT 4084 4084 R -> Q (in dbSNP:rs200431386).
{ECO:0000269|PubMed:11846417}.
/FTId=VAR_026691.
VARIANT 4215 4215 T -> P (in dbSNP:rs2562829).
{ECO:0000269|PubMed:10051295,
ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:11846417,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_026635.
VARIANT 4238 4238 G -> W (in dbSNP:rs56030296).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040131.
VARIANT 4283 4283 L -> F (in dbSNP:rs1883085).
{ECO:0000269|PubMed:10051295,
ECO:0000269|PubMed:10850961,
ECO:0000269|PubMed:11717165,
ECO:0000269|PubMed:17344846}.
/FTId=VAR_026636.
VARIANT 4291 4291 I -> T (in a colorectal adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040132.
VARIANT 4303 4303 G -> D (in dbSNP:rs55857742).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040133.
VARIANT 4427 4427 D -> E (in dbSNP:rs55906845).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040134.
VARIANT 4465 4465 S -> N (in CMD1G; dbSNP:rs281864908).
{ECO:0000269|PubMed:11846417}.
/FTId=VAR_026692.
VARIANT 8288 8288 A -> V (in dbSNP:rs16866412).
/FTId=VAR_056085.
VARIANT 8474 8474 I -> T (in dbSNP:rs4893852).
/FTId=VAR_056086.
VARIANT 12310 12310 G -> E (in dbSNP:rs55723264).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040135.
VARIANT 12383 12383 H -> R (in dbSNP:rs2288563).
{ECO:0000269|PubMed:10850961}.
/FTId=VAR_040136.
VARIANT 12469 12469 V -> A (in dbSNP:rs34706299).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040137.
VARIANT 12642 12642 R -> C (in a gastric adenocarcinoma
sample; somatic mutation;
dbSNP:rs199684560).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040138.
VARIANT 12657 12657 E -> K (in a Wilms tumor; somatic
mutation; dbSNP:rs778634417).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040139.
VARIANT 12679 12679 K -> E (in dbSNP:rs6723526).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040140.
VARIANT 12720 12720 S -> F (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040141.
VARIANT 12798 12798 R -> C (in dbSNP:rs200914097).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040142.
VARIANT 13049 13049 E -> G. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040143.
VARIANT 13083 13083 E -> K (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040144.
VARIANT 13096 13096 R -> L (in dbSNP:rs373298007).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040145.
VARIANT 13099 13099 Q -> R (in a lung small cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040146.
VARIANT 13297 13297 V -> A (in dbSNP:rs571522834).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040147.
VARIANT 13399 13399 I -> M (in dbSNP:rs74580375).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040148.
VARIANT 13418 13418 A -> T (in dbSNP:rs144668626).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040149.
VARIANT 13428 13428 E -> V (in dbSNP:rs114331773).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040150.
VARIANT 13430 13430 I -> T (in dbSNP:rs184078045).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040151.
VARIANT 13434 13434 R -> K (in a breast pleomorphic lobular
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040152.
VARIANT 13469 13469 D -> N (in dbSNP:rs17354992).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040153.
VARIANT 13495 13495 K -> N (in dbSNP:rs72677225).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040154.
VARIANT 13785 13785 N -> S (in a breast pleomorphic lobular
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040155.
VARIANT 13870 13870 Q -> H (in a lung small cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040156.
VARIANT 14109 14109 V -> I (in dbSNP:rs72677232).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040157.
VARIANT 14131 14131 R -> Q (in dbSNP:rs72677233).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040158.
VARIANT 14208 14208 P -> T (in dbSNP:rs146181477).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040159.
VARIANT 14728 14728 L -> V (in a lung adenocarcinoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040160.
VARIANT 14750 14750 R -> Q (in dbSNP:rs200944827).
{ECO:0000269|PubMed:25173926}.
/FTId=VAR_074294.
VARIANT 14999 14999 S -> T (in dbSNP:rs55663050).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040161.
VARIANT 15021 15021 N -> T (in dbSNP:rs36043230).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040162.
VARIANT 15520 15520 A -> V (in dbSNP:rs16866412).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040163.
VARIANT 15555 15555 R -> I (in a colorectal adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040164.
VARIANT 15620 15620 R -> Q (in dbSNP:rs201825412).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040165.
VARIANT 15629 15629 S -> I (in dbSNP:rs200650668).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040166.
VARIANT 15635 15635 Y -> C (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040167.
VARIANT 15700 15700 R -> Q (in dbSNP:rs370390570).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040168.
VARIANT 15705 15705 L -> P (in dbSNP:rs755155531).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040169.
VARIANT 15837 15837 I -> M (in dbSNP:rs554368924).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040170.
VARIANT 16046 16046 G -> V (in dbSNP:rs780672348).
{ECO:0000269|PubMed:23033978}.
/FTId=VAR_069432.
VARIANT 16058 16058 R -> H (in dbSNP:rs72646808).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040171.
VARIANT 16067 16067 K -> I (in dbSNP:rs2303832).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040172.
VARIANT 16090 16090 I -> T (in dbSNP:rs72646809).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040173.
VARIANT 16195 16195 R -> H (in a gastric adenocarcinoma
sample; somatic mutation;
dbSNP:rs373526624).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040174.
VARIANT 16409 16409 R -> C (in dbSNP:rs55734111).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040175.
VARIANT 16424 16424 R -> P. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040176.
VARIANT 16575 16575 V -> M (in dbSNP:rs3813243).
/FTId=VAR_056087.
VARIANT 16629 16629 I -> M (in dbSNP:rs55809450).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040177.
VARIANT 16877 16877 K -> R (in dbSNP:rs72646823).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040178.
VARIANT 17060 17060 N -> D (in dbSNP:rs1001238).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040179.
VARIANT 17637 17637 I -> V (in dbSNP:rs56025724).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040180.
VARIANT 17838 17838 R -> H (in dbSNP:rs2288569).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040181.
VARIANT 17866 17866 D -> N. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040182.
VARIANT 17906 17906 G -> E (in a metastatic melanoma sample;
somatic mutation; dbSNP:rs374713701).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040183.
VARIANT 18094 18094 E -> A (in dbSNP:rs769852851).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040184.
VARIANT 18109 18109 G -> S (in dbSNP:rs200732032).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040185.
VARIANT 18164 18164 R -> T (in an ovarian serous carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040186.
VARIANT 18221 18221 P -> L (in dbSNP:rs16866406).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040187.
VARIANT 18222 18222 A -> T. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040188.
VARIANT 18726 18726 R -> Q (in dbSNP:rs141973925).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040189.
VARIANT 18835 18835 V -> A (in a breast infiltrating ductal
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040190.
VARIANT 18881 18881 R -> K (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040191.
VARIANT 18939 18939 N -> S. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040192.
VARIANT 19000 19000 R -> Q (in dbSNP:rs199895260).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040193.
VARIANT 19060 19060 L -> Q (in a lung large cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040194.
VARIANT 19091 19091 R -> K (in a lung large cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040195.
VARIANT 19224 19224 P -> S (in a colorectal adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040196.
VARIANT 19367 19367 T -> I (in dbSNP:rs72646850).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040197.
VARIANT 19392 19392 E -> K (in a lung neuroendocrine
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040198.
VARIANT 19480 19480 A -> S (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040199.
VARIANT 19495 19495 D -> G (in dbSNP:rs773075736).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040200.
VARIANT 19665 19665 R -> H (in dbSNP:rs202240487).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040201.
VARIANT 19762 19762 T -> I (in dbSNP:rs2042996).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040202.
VARIANT 19947 19947 G -> R (in dbSNP:rs181717727).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040203.
VARIANT 19956 19956 V -> M (in dbSNP:rs150661999).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040204.
VARIANT 19992 19992 R -> Q (in dbSNP:rs141965360).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040205.
VARIANT 20057 20057 R -> C (in dbSNP:rs72646861).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040206.
VARIANT 20075 20075 S -> L (in dbSNP:rs13021201).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040207.
VARIANT 20179 20179 T -> K. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040208.
VARIANT 20198 20198 A -> T (in dbSNP:rs56378177).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040209.
VARIANT 20198 20198 A -> V (in dbSNP:rs55948748).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040210.
VARIANT 20331 20331 R -> H (in dbSNP:rs200217934).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040211.
VARIANT 20359 20359 R -> K (in dbSNP:rs9808036).
/FTId=VAR_056088.
VARIANT 20408 20408 A -> T (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040212.
VARIANT 20564 20564 R -> K (in dbSNP:rs72646869).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040213.
VARIANT 20718 20718 V -> I (in dbSNP:rs2303838).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040214.
VARIANT 20726 20726 S -> P (in dbSNP:rs72646873).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040215.
VARIANT 20892 20892 T -> N. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040216.
VARIANT 20894 20894 S -> R. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040217.
VARIANT 21125 21125 D -> E (in dbSNP:rs534340303).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040218.
VARIANT 21403 21403 P -> S (in dbSNP:rs55980498).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040219.
VARIANT 21730 21730 R -> C (in dbSNP:rs56141309).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040220.
VARIANT 21747 21747 R -> Q (in dbSNP:rs55853138).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040221.
VARIANT 21851 21851 C -> R (in a gastric adenocarcinoma
sample; somatic mutation;
dbSNP:rs55713867).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040222.
VARIANT 21925 21925 G -> R (in dbSNP:rs55801134).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040223.
VARIANT 21995 21995 R -> H (in dbSNP:rs56071233).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040224.
VARIANT 22045 22045 A -> V (in dbSNP:rs55903402).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040225.
VARIANT 22149 22149 R -> H (in dbSNP:rs55677134).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040226.
VARIANT 22160 22160 V -> I (in dbSNP:rs55885640).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040227.
VARIANT 22261 22261 I -> T (in dbSNP:rs55837610).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040228.
VARIANT 22306 22306 K -> N (in dbSNP:rs56019808).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040229.
VARIANT 22357 22357 R -> H (in dbSNP:rs10164753).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040230.
VARIANT 22408 22408 L -> P (in dbSNP:rs56399205).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040231.
VARIANT 22537 22537 Q -> H (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040232.
VARIANT 22584 22584 P -> L (in dbSNP:rs55992239).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040233.
VARIANT 22646 22646 L -> P (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040234.
VARIANT 22670 22670 T -> A (in dbSNP:rs56201325).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040235.
VARIANT 22770 22770 A -> D (in dbSNP:rs55991022).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040236.
VARIANT 22801 22801 A -> T (in a metastatic melanoma sample;
somatic mutation; dbSNP:rs764005465).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040237.
VARIANT 22823 22823 R -> W (in a metastatic melanoma sample;
somatic mutation; dbSNP:rs369098292).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040238.
VARIANT 22968 22968 E -> Q (in dbSNP:rs55762754).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040239.
VARIANT 23074 23074 P -> L (in dbSNP:rs55713856).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040240.
VARIANT 23079 23079 L -> F (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040241.
VARIANT 23282 23282 D -> N (in a breast infiltrating ductal
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040242.
VARIANT 23303 23303 H -> Y (in a metastatic melanoma sample;
somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040243.
VARIANT 23306 23306 R -> C (in dbSNP:rs744426).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040244.
VARIANT 23515 23515 A -> S (in a lung squamous cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040245.
VARIANT 23551 23551 E -> Q (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040246.
VARIANT 23807 23807 S -> N (in dbSNP:rs3813243).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040247.
VARIANT 23872 23872 D -> N (in an ovarian serous carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040248.
VARIANT 23891 23891 V -> A (in dbSNP:rs55984930).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040249.
VARIANT 23933 23933 Y -> H (in dbSNP:rs3813245).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040250.
VARIANT 23939 23939 T -> M (in dbSNP:rs56372592).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040251.
VARIANT 23952 23952 F -> L (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040252.
VARIANT 24098 24098 A -> G (in dbSNP:rs56391938).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040253.
VARIANT 24098 24098 A -> T (in dbSNP:rs4894028).
/FTId=VAR_056089.
VARIANT 24119 24119 N -> S (in dbSNP:rs3813246).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040254.
VARIANT 24133 24133 V -> I (in dbSNP:rs56340968).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040255.
VARIANT 24159 24159 V -> A (in a head and neck squamous cell
carcinoma sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040256.
VARIANT 24239 24239 T -> A (in dbSNP:rs56018860).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040257.
VARIANT 24265 24265 E -> K (in dbSNP:rs56341835).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040258.
VARIANT 24584 24584 I -> T (in dbSNP:rs12463674).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040259.
VARIANT 24781 24781 I -> T (in dbSNP:rs3731745).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040260.
VARIANT 24799 24799 R -> H (in dbSNP:rs56044609).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040261.
VARIANT 24954 24954 D -> H (in dbSNP:rs56307213).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040262.
VARIANT 24980 24980 T -> M (in dbSNP:rs3731746).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040263.
VARIANT 25659 25659 R -> H (in dbSNP:rs55850344).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040264.
VARIANT 25679 25679 A -> T (in dbSNP:rs56365600).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040265.
VARIANT 25720 25720 P -> A (in dbSNP:rs56137800).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040266.
VARIANT 25821 25821 T -> K (in dbSNP:rs55933739).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040267.
VARIANT 25859 25859 E -> K (in a metastatic melanoma sample;
somatic mutation; dbSNP:rs375422359).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040268.
VARIANT 25879 25879 N -> K (in dbSNP:rs56264840).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040269.
VARIANT 25923 25923 A -> V (in dbSNP:rs55634791).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040270.
VARIANT 26045 26045 V -> I (in dbSNP:rs56309296).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040271.
VARIANT 26059 26059 K -> E (in a lung small cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040272.
VARIANT 26134 26134 I -> V (in dbSNP:rs3829746).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040273.
VARIANT 26477 26477 R -> C (in dbSNP:rs56057221).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040274.
VARIANT 26843 26843 D -> Y (in dbSNP:rs56330345).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040275.
VARIANT 27346 27346 K -> R. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040276.
VARIANT 27652 27652 R -> C (in dbSNP:rs191482653).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040277.
VARIANT 27728 27728 G -> V (in dbSNP:rs55898359).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040278.
VARIANT 27754 27754 F -> L (in dbSNP:rs55940667).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040279.
VARIANT 27755 27755 I -> T (in dbSNP:rs9808377).
{ECO:0000269|PubMed:17344846,
ECO:0000269|PubMed:7569978}.
/FTId=VAR_040280.
VARIANT 27929 27929 I -> V (in dbSNP:rs139506970).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040281.
VARIANT 28132 28132 I -> L (in dbSNP:rs77853750).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040282.
VARIANT 28168 28168 R -> Q (in dbSNP:rs72648238).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040283.
VARIANT 28538 28538 R -> H (in dbSNP:rs149567378).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040284.
VARIANT 28572 28572 I -> T (in dbSNP:rs114026724).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040285.
VARIANT 28948 28948 A -> T (in dbSNP:rs148617456).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040286.
VARIANT 28986 28986 I -> V (in dbSNP:rs535151633).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040287.
VARIANT 28993 28993 G -> E (in dbSNP:rs376628842).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040288.
VARIANT 28998 28998 L -> V (in dbSNP:rs373049260).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040289.
VARIANT 29070 29070 V -> M (in dbSNP:rs747122).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040290.
VARIANT 29090 29090 I -> V (in dbSNP:rs16866391).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040291.
VARIANT 29419 29419 R -> C (in dbSNP:rs750303653).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040292.
VARIANT 29479 29479 L -> P. {ECO:0000269|PubMed:17344846}.
/FTId=VAR_040293.
VARIANT 29880 29880 S -> L (in a colorectal adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040294.
VARIANT 29976 29976 D -> E (in dbSNP:rs72648256).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040295.
VARIANT 30042 30042 S -> G (in dbSNP:rs72648257).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040296.
VARIANT 30107 30107 R -> C (in dbSNP:rs142525903).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040297.
VARIANT 30125 30125 S -> F (in dbSNP:rs191484894).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040298.
VARIANT 30211 30211 L -> P (in dbSNP:rs62621206).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040299.
VARIANT 30412 30412 I -> T (in dbSNP:rs62621236).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040300.
VARIANT 30617 30617 T -> S (in a renal chromophobe cancer
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040301.
VARIANT 30674 30674 T -> I (in dbSNP:rs56027402).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040302.
VARIANT 30809 30809 V -> I (in a gastric adenocarcinoma
sample; somatic mutation;
dbSNP:rs397517769).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040303.
VARIANT 30818 30818 F -> I (in dbSNP:rs56009327).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040304.
VARIANT 30825 30825 E -> K (in dbSNP:rs55915651).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040305.
VARIANT 30856 30856 I -> T (in dbSNP:rs55660660).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040306.
VARIANT 30887 30887 G -> D (in dbSNP:rs56066673).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040307.
VARIANT 30887 30887 G -> S (in dbSNP:rs56233675).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040308.
VARIANT 30897 30897 R -> H (in dbSNP:rs3731749).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040309.
VARIANT 30907 30907 R -> H (in dbSNP:rs55676195).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040310.
VARIANT 30946 30946 R -> H (in dbSNP:rs55704830).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040311.
VARIANT 31081 31081 I -> F (in dbSNP:rs72648270).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040312.
VARIANT 31107 31107 R -> C (in dbSNP:rs72648272).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040313.
VARIANT 31124 31124 A -> G (in dbSNP:rs72648273).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040314.
VARIANT 31156 31156 N -> S (in dbSNP:rs149001703).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040315.
VARIANT 31246 31246 P -> T (in dbSNP:rs55653324).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040316.
VARIANT 31330 31330 R -> H (in dbSNP:rs4894028).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040317.
VARIANT 31690 31690 C -> R (in dbSNP:rs56061641).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040318.
VARIANT 31724 31724 R -> Q (in dbSNP:rs55742743).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040319.
VARIANT 31725 31725 V -> I (in dbSNP:rs55675869).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040320.
VARIANT 31732 31732 G -> S (in dbSNP:rs55880786).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040321.
VARIANT 31886 31886 V -> I (in dbSNP:rs2278196).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040322.
VARIANT 32097 32097 R -> C (in dbSNP:rs56273463).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040323.
VARIANT 32171 32171 T -> N (in a lung large cell carcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040324.
VARIANT 32248 32248 V -> I (in dbSNP:rs34924609).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040325.
VARIANT 32281 32281 Q -> H (in dbSNP:rs55886356).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040326.
VARIANT 32323 32323 R -> H (in dbSNP:rs55669553).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040327.
VARIANT 32411 32411 R -> W (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040328.
VARIANT 32558 32558 I -> V (in dbSNP:rs56347248).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040329.
VARIANT 32610 32610 M -> V (in dbSNP:rs56173891).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040330.
VARIANT 32637 32637 G -> V (in dbSNP:rs3731752).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040331.
VARIANT 32742 32742 E -> Q (in dbSNP:rs148525155).
{ECO:0000269|PubMed:23033978}.
/FTId=VAR_069433.
VARIANT 32922 32922 V -> A (in dbSNP:rs55945684).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040332.
VARIANT 32943 32943 L -> R (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040333.
VARIANT 32953 32953 R -> H (in dbSNP:rs3829747).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040334.
VARIANT 32996 32996 R -> Q (in CMD1G; dbSNP:rs199642423).
{ECO:0000269|PubMed:16465475}.
/FTId=VAR_026693.
VARIANT 33213 33213 V -> L (in dbSNP:rs55866005).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040335.
VARIANT 33242 33242 R -> C (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040336.
VARIANT 33387 33387 T -> M (in dbSNP:rs56001826).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040337.
VARIANT 33419 33419 E -> D (in dbSNP:rs56308529).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040338.
VARIANT 33536 33536 V -> M (in dbSNP:rs55865284).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040339.
VARIANT 33568 33568 K -> Q (in dbSNP:rs56365812).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040340.
VARIANT 33616 33616 E -> K (in dbSNP:rs56324595).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040341.
VARIANT 33620 33620 P -> L (in dbSNP:rs16866380).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040342.
VARIANT 33886 33886 E -> V (in dbSNP:rs55725279).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040343.
VARIANT 33899 33899 I -> T (in dbSNP:rs55880440).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040344.
VARIANT 33904 33904 L -> P (in a gastric adenocarcinoma
sample; somatic mutation).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040345.
VARIANT 33955 33955 T -> I (in dbSNP:rs55842557).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040346.
VARIANT 34115 34115 V -> A (in dbSNP:rs16866378).
{ECO:0000269|PubMed:17344846}.
/FTId=VAR_040347.
VARIANT 34306 34306 I -> N (in TMD; dbSNP:rs281864928).
{ECO:0000269|PubMed:12891679}.
/FTId=VAR_026694.
VARIANT 34315 34315 L -> P (in TMD; dbSNP:rs267607156).
{ECO:0000269|PubMed:12145747}.
/FTId=VAR_026695.
MUTAGEN 32207 32207 K->A: Disrupts catalytic activity.
{ECO:0000269|PubMed:9804419}.
MUTAGEN 32341 32341 Y->E: No phosphorylation on tyrosine.
{ECO:0000269|PubMed:9804419}.
CONFLICT 132 132 T -> N (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 255 255 P -> H (in Ref. 3; CAD12455/CAD12456/
CAD12457). {ECO:0000305}.
CONFLICT 1472 1474 QTA -> ANC (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 1730 1730 G -> S (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 3919 3919 P -> L (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 4525 4525 R -> K (in Ref. 3; CAD12456).
{ECO:0000305}.
CONFLICT 6619 6619 R -> E (in Ref. 1; CAA62189 and 3;
CAD12456). {ECO:0000305}.
CONFLICT 7145 7145 D -> H (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 7441 7441 S -> N (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 8038 8038 A -> E (in Ref. 3; CAD12456).
{ECO:0000305}.
CONFLICT 8225 8225 Q -> H (in Ref. 3; CAD12456).
{ECO:0000305}.
CONFLICT 8850 8850 A -> P (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 9693 9693 C -> V (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 9892 9892 I -> V (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 10205 10205 I -> V (in Ref. 3; CAD12456 and 9;
AAP80791). {ECO:0000305}.
CONFLICT 10305 10305 G -> R (in Ref. 3; CAD12456).
{ECO:0000305}.
CONFLICT 10566 10566 R -> K (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 10779 10779 R -> H (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 11424 11424 E -> D (in Ref. 3; CAD12456).
{ECO:0000305}.
CONFLICT 11511 11511 A -> V (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 11626 11626 K -> N (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 11838 11838 K -> N (in Ref. 1; CAA62189).
{ECO:0000305}.
CONFLICT 12994 12994 A -> T (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 13795 13797 YKF -> IQI (in Ref. 11). {ECO:0000305}.
CONFLICT 14590 14590 A -> T (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 14792 14792 V -> A (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 15974 15974 E -> K (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 16234 16235 TK -> QR (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 17238 17238 R -> H (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 17423 17423 R -> S (in Ref. 3; CAD12456).
{ECO:0000305}.
CONFLICT 19734 19734 V -> A (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 20517 20517 G -> A (in Ref. 1; CAA62188 and 3;
CAD12455). {ECO:0000305}.
CONFLICT 20622 20622 L -> H (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 20775 20775 A -> P (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 21625 21625 Y -> I (in Ref. 13; CAA45939).
{ECO:0000305}.
CONFLICT 21795 21800 PGPVLN -> ARPSPQ (in Ref. 13; CAA45939).
{ECO:0000305}.
CONFLICT 22176 22176 C -> W (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 22816 22816 A -> D (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 22837 22837 T -> A (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 24176 24176 I -> M (in Ref. 1; CAA62188 and 13;
CAA45940). {ECO:0000305}.
CONFLICT 24181 24181 S -> F (in Ref. 13; CAA45940).
{ECO:0000305}.
CONFLICT 25731 25731 P -> S (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 26573 26573 M -> V (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 26846 26848 IVE -> HRK (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 27879 27879 G -> A (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 28936 28936 D -> N (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 29222 29222 A -> T (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 29518 29518 F -> L (in Ref. 1; CAA62188).
{ECO:0000305}.
CONFLICT 29701 29701 T -> P (in Ref. 14; CAA45938/CAA49245).
{ECO:0000305}.
CONFLICT 29873 29873 E -> G (in Ref. 14; CAA45938/CAA49245).
{ECO:0000305}.
CONFLICT 29878 29878 T -> Q (in Ref. 14; CAA45938/CAA49245).
{ECO:0000305}.
CONFLICT 30209 30209 K -> E (in Ref. 1; CAA62188 and 14;
CAA45938/CAA49245). {ECO:0000305}.
CONFLICT 30256 30256 A -> R (in Ref. 1; CAA62188 and 14;
CAA45938/CAA49245). {ECO:0000305}.
CONFLICT 30496 30496 V -> I (in Ref. 1; CAA62188 and 14;
CAA45938/CAA49245). {ECO:0000305}.
CONFLICT 30534 30534 Y -> H (in Ref. 1; CAA62188 and 14;
CAA45938/CAA49245). {ECO:0000305}.
CONFLICT 30748 30748 S -> L (in Ref. 14; CAA45938/CAA49245).
{ECO:0000305}.
CONFLICT 31303 31303 W -> V (in Ref. 1; CAA62188 and 14;
CAA45938/CAA49245). {ECO:0000305}.
CONFLICT 32060 32060 V -> A (in Ref. 1; CAA62188 and 14;
CAA45938/CAA49245). {ECO:0000305}.
CONFLICT 33084 33084 D -> N (in Ref. 1; CAA62188 and 14;
CAA49245). {ECO:0000305}.
CONFLICT 33120 33120 R -> W (in Ref. 15; CAD28458).
{ECO:0000305}.
CONFLICT 33382 33382 A -> R (in Ref. 14; CAA49245).
{ECO:0000305}.
CONFLICT 33424 33424 S -> P (in Ref. 1; CAA62188 and 14;
CAA49245). {ECO:0000305}.
CONFLICT 33526 33526 Q -> R (in Ref. 14; CAA49245).
{ECO:0000305}.
CONFLICT 33633 33633 T -> I (in Ref. 1; CAA62188 and 14;
CAA49245). {ECO:0000305}.
CONFLICT 33716 33716 Y -> V (in Ref. 15; CAD28458).
{ECO:0000305}.
CONFLICT 33995 33995 V -> A (in Ref. 15; CAD28458).
{ECO:0000305}.
CONFLICT 34071 34071 N -> G (in Ref. 5; AAI07798).
{ECO:0000305}.
CONFLICT 34082 34082 C -> R (in Ref. 14; CAA49245).
{ECO:0000305}.
CONFLICT 34253 34253 G -> R (in Ref. 5; AAI07798).
{ECO:0000305}.
STRAND 4 10 {ECO:0000244|PDB:2A38}.
STRAND 15 18 {ECO:0000244|PDB:2A38}.
STRAND 23 33 {ECO:0000244|PDB:2A38}.
STRAND 36 45 {ECO:0000244|PDB:2A38}.
TURN 48 50 {ECO:0000244|PDB:2A38}.
STRAND 55 59 {ECO:0000244|PDB:2A38}.
STRAND 62 69 {ECO:0000244|PDB:2A38}.
HELIX 72 74 {ECO:0000244|PDB:2A38}.
STRAND 76 84 {ECO:0000244|PDB:2A38}.
STRAND 87 98 {ECO:0000244|PDB:2A38}.
STRAND 102 108 {ECO:0000244|PDB:2A38}.
STRAND 113 116 {ECO:0000244|PDB:2A38}.
STRAND 119 131 {ECO:0000244|PDB:2A38}.
STRAND 134 139 {ECO:0000244|PDB:2A38}.
STRAND 142 144 {ECO:0000244|PDB:1YA5}.
STRAND 147 155 {ECO:0000244|PDB:2A38}.
STRAND 158 166 {ECO:0000244|PDB:2A38}.
HELIX 168 170 {ECO:0000244|PDB:2A38}.
STRAND 172 180 {ECO:0000244|PDB:2A38}.
STRAND 183 194 {ECO:0000244|PDB:2A38}.
STRAND 2076 2082 {ECO:0000244|PDB:1G1C}.
STRAND 2087 2090 {ECO:0000244|PDB:1G1C}.
STRAND 2095 2105 {ECO:0000244|PDB:1G1C}.
STRAND 2108 2113 {ECO:0000244|PDB:1G1C}.
STRAND 2122 2130 {ECO:0000244|PDB:1G1C}.
STRAND 2133 2138 {ECO:0000244|PDB:1G1C}.
HELIX 2143 2145 {ECO:0000244|PDB:1G1C}.
STRAND 2147 2155 {ECO:0000244|PDB:1G1C}.
STRAND 2158 2169 {ECO:0000244|PDB:1G1C}.
STRAND 2797 2799 {ECO:0000244|PDB:5JDD}.
STRAND 2804 2807 {ECO:0000244|PDB:5JDD}.
STRAND 2812 2820 {ECO:0000244|PDB:5JDD}.
STRAND 2826 2829 {ECO:0000244|PDB:5JDD}.
STRAND 2838 2845 {ECO:0000244|PDB:5JDD}.
STRAND 2848 2853 {ECO:0000244|PDB:5JDD}.
HELIX 2858 2860 {ECO:0000244|PDB:5JDD}.
STRAND 2862 2868 {ECO:0000244|PDB:5JDD}.
STRAND 2871 2880 {ECO:0000244|PDB:5JDD}.
STRAND 2884 2886 {ECO:0000244|PDB:5JDD}.
STRAND 2891 2894 {ECO:0000244|PDB:5JDD}.
STRAND 2899 2907 {ECO:0000244|PDB:5JDD}.
STRAND 2914 2916 {ECO:0000244|PDB:5JDD}.
STRAND 2924 2932 {ECO:0000244|PDB:5JDD}.
STRAND 2935 2940 {ECO:0000244|PDB:5JDD}.
HELIX 2945 2947 {ECO:0000244|PDB:5JDD}.
STRAND 2949 2955 {ECO:0000244|PDB:5JDD}.
STRAND 2958 2967 {ECO:0000244|PDB:5JDD}.
STRAND 2971 2973 {ECO:0000244|PDB:5JDD}.
STRAND 2978 2981 {ECO:0000244|PDB:5JDD}.
STRAND 2986 2994 {ECO:0000244|PDB:5JDD}.
STRAND 3000 3003 {ECO:0000244|PDB:5JDD}.
STRAND 3012 3019 {ECO:0000244|PDB:5JDD}.
STRAND 3022 3027 {ECO:0000244|PDB:5JDD}.
HELIX 3032 3034 {ECO:0000244|PDB:5JDD}.
STRAND 3036 3042 {ECO:0000244|PDB:5JDD}.
STRAND 3045 3053 {ECO:0000244|PDB:5JDD}.
STRAND 9582 9587 {ECO:0000244|PDB:5JOE}.
STRAND 9592 9595 {ECO:0000244|PDB:5JOE}.
STRAND 9600 9608 {ECO:0000244|PDB:5JOE}.
STRAND 9616 9619 {ECO:0000244|PDB:5JOE}.
STRAND 9628 9635 {ECO:0000244|PDB:5JOE}.
STRAND 9638 9643 {ECO:0000244|PDB:5JOE}.
HELIX 9648 9650 {ECO:0000244|PDB:5JOE}.
STRAND 9652 9658 {ECO:0000244|PDB:5JOE}.
STRAND 9661 9670 {ECO:0000244|PDB:5JOE}.
STRAND 12680 12682 {ECO:0000244|PDB:1WAA}.
STRAND 12687 12690 {ECO:0000244|PDB:1WAA}.
STRAND 12691 12693 {ECO:0000244|PDB:1TIT}.
STRAND 12695 12705 {ECO:0000244|PDB:1WAA}.
STRAND 12709 12712 {ECO:0000244|PDB:1WAA}.
STRAND 12719 12722 {ECO:0000244|PDB:1TIU}.
STRAND 12723 12728 {ECO:0000244|PDB:1WAA}.
STRAND 12731 12736 {ECO:0000244|PDB:1WAA}.
HELIX 12741 12743 {ECO:0000244|PDB:1WAA}.
STRAND 12745 12751 {ECO:0000244|PDB:1WAA}.
STRAND 12754 12763 {ECO:0000244|PDB:1WAA}.
STRAND 14223 14228 {ECO:0000244|PDB:4O00}.
STRAND 14232 14240 {ECO:0000244|PDB:4O00}.
STRAND 14252 14259 {ECO:0000244|PDB:4O00}.
STRAND 14275 14281 {ECO:0000244|PDB:4O00}.
STRAND 14288 14296 {ECO:0000244|PDB:4O00}.
STRAND 14308 14314 {ECO:0000244|PDB:4O00}.
STRAND 22291 22296 {ECO:0000244|PDB:1BPV}.
STRAND 22299 22303 {ECO:0000244|PDB:1BPV}.
STRAND 22319 22324 {ECO:0000244|PDB:1BPV}.
STRAND 22340 22345 {ECO:0000244|PDB:1BPV}.
STRAND 22354 22361 {ECO:0000244|PDB:1BPV}.
STRAND 22367 22377 {ECO:0000244|PDB:1BPV}.
HELIX 22381 22384 {ECO:0000244|PDB:1BPV}.
STRAND 22883 22890 {ECO:0000244|PDB:3LPW}.
STRAND 22895 22900 {ECO:0000244|PDB:3LPW}.
STRAND 22912 22919 {ECO:0000244|PDB:3LPW}.
STRAND 22926 22932 {ECO:0000244|PDB:3LPW}.
STRAND 22934 22939 {ECO:0000244|PDB:3LPW}.
STRAND 22947 22956 {ECO:0000244|PDB:3LPW}.
STRAND 22970 22972 {ECO:0000244|PDB:3LPW}.
STRAND 22982 22987 {ECO:0000244|PDB:3LPW}.
STRAND 22992 22996 {ECO:0000244|PDB:3LPW}.
STRAND 23009 23016 {ECO:0000244|PDB:3LPW}.
STRAND 23023 23035 {ECO:0000244|PDB:3LPW}.
STRAND 23043 23052 {ECO:0000244|PDB:3LPW}.
STRAND 31458 31464 {ECO:0000244|PDB:3LCY}.
STRAND 31469 31472 {ECO:0000244|PDB:3LCY}.
STRAND 31475 31487 {ECO:0000244|PDB:3LCY}.
STRAND 31490 31495 {ECO:0000244|PDB:3LCY}.
STRAND 31498 31500 {ECO:0000244|PDB:3LCY}.
STRAND 31504 31520 {ECO:0000244|PDB:3LCY}.
HELIX 31524 31526 {ECO:0000244|PDB:3LCY}.
STRAND 31528 31535 {ECO:0000244|PDB:3LCY}.
STRAND 31540 31555 {ECO:0000244|PDB:3LCY}.
STRAND 31563 31568 {ECO:0000244|PDB:3LCY}.
STRAND 31573 31583 {ECO:0000244|PDB:3LCY}.
STRAND 31586 31591 {ECO:0000244|PDB:3LCY}.
STRAND 31600 31606 {ECO:0000244|PDB:3LCY}.
STRAND 31608 31617 {ECO:0000244|PDB:3LCY}.
HELIX 31620 31623 {ECO:0000244|PDB:3LCY}.
STRAND 31625 31632 {ECO:0000244|PDB:3LCY}.
STRAND 31637 31647 {ECO:0000244|PDB:3LCY}.
STRAND 31856 31859 {ECO:0000244|PDB:2J8H}.
STRAND 31864 31867 {ECO:0000244|PDB:2J8H}.
STRAND 31872 31879 {ECO:0000244|PDB:2J8H}.
STRAND 31885 31890 {ECO:0000244|PDB:2J8H}.
STRAND 31893 31895 {ECO:0000244|PDB:2J8O}.
STRAND 31899 31907 {ECO:0000244|PDB:2J8H}.
TURN 31908 31910 {ECO:0000244|PDB:2J8H}.
STRAND 31911 31916 {ECO:0000244|PDB:2J8H}.
HELIX 31921 31923 {ECO:0000244|PDB:2J8H}.
STRAND 31925 31933 {ECO:0000244|PDB:2J8H}.
STRAND 31936 31952 {ECO:0000244|PDB:2J8H}.
HELIX 31956 31959 {ECO:0000244|PDB:2NZI}.
STRAND 31961 31967 {ECO:0000244|PDB:2J8H}.
STRAND 31973 31982 {ECO:0000244|PDB:2J8H}.
STRAND 31985 31992 {ECO:0000244|PDB:2J8H}.
STRAND 31997 32000 {ECO:0000244|PDB:2J8H}.
STRAND 32002 32005 {ECO:0000244|PDB:2J8H}.
STRAND 32007 32013 {ECO:0000244|PDB:2J8H}.
HELIX 32020 32022 {ECO:0000244|PDB:2J8H}.
STRAND 32024 32032 {ECO:0000244|PDB:2J8H}.
STRAND 32035 32046 {ECO:0000244|PDB:2J8H}.
STRAND 32053 32059 {ECO:0000244|PDB:2NZI}.
STRAND 32065 32070 {ECO:0000244|PDB:2NZI}.
STRAND 32076 32078 {ECO:0000244|PDB:2NZI}.
STRAND 32080 32089 {ECO:0000244|PDB:2NZI}.
STRAND 32095 32108 {ECO:0000244|PDB:2NZI}.
STRAND 32116 32125 {ECO:0000244|PDB:2NZI}.
TURN 32175 32177 {ECO:0000244|PDB:1TKI}.
STRAND 32178 32186 {ECO:0000244|PDB:1TKI}.
STRAND 32188 32197 {ECO:0000244|PDB:1TKI}.
TURN 32198 32201 {ECO:0000244|PDB:1TKI}.
STRAND 32202 32209 {ECO:0000244|PDB:1TKI}.
HELIX 32214 32228 {ECO:0000244|PDB:1TKI}.
STRAND 32237 32243 {ECO:0000244|PDB:1TKI}.
STRAND 32246 32251 {ECO:0000244|PDB:1TKI}.
HELIX 32259 32263 {ECO:0000244|PDB:1TKI}.
STRAND 32265 32267 {ECO:0000244|PDB:1TKI}.
HELIX 32272 32291 {ECO:0000244|PDB:1TKI}.
HELIX 32301 32303 {ECO:0000244|PDB:1TKI}.
STRAND 32304 32310 {ECO:0000244|PDB:1TKI}.
STRAND 32314 32316 {ECO:0000244|PDB:1TKI}.
STRAND 32330 32336 {ECO:0000244|PDB:1TKI}.
HELIX 32338 32340 {ECO:0000244|PDB:1TKI}.
HELIX 32343 32346 {ECO:0000244|PDB:1TKI}.
HELIX 32353 32369 {ECO:0000244|PDB:1TKI}.
HELIX 32379 32388 {ECO:0000244|PDB:1TKI}.
HELIX 32395 32398 {ECO:0000244|PDB:1TKI}.
HELIX 32403 32410 {ECO:0000244|PDB:1TKI}.
HELIX 32417 32419 {ECO:0000244|PDB:1TKI}.
HELIX 32423 32428 {ECO:0000244|PDB:1TKI}.
HELIX 32430 32433 {ECO:0000244|PDB:1TKI}.
HELIX 32436 32438 {ECO:0000244|PDB:1TKI}.
HELIX 32447 32457 {ECO:0000244|PDB:1TKI}.
HELIX 32466 32472 {ECO:0000244|PDB:1TKI}.
STRAND 32474 32476 {ECO:0000244|PDB:1TKI}.
STRAND 32483 32489 {ECO:0000244|PDB:1TKI}.
STRAND 32504 32506 {ECO:0000244|PDB:2BK8}.
STRAND 32512 32520 {ECO:0000244|PDB:2BK8}.
STRAND 32526 32531 {ECO:0000244|PDB:2BK8}.
STRAND 32538 32547 {ECO:0000244|PDB:2BK8}.
STRAND 32550 32555 {ECO:0000244|PDB:2BK8}.
HELIX 32560 32562 {ECO:0000244|PDB:2BK8}.
STRAND 32564 32571 {ECO:0000244|PDB:2BK8}.
STRAND 32576 32585 {ECO:0000244|PDB:2BK8}.
TURN 32586 32588 {ECO:0000244|PDB:2BK8}.
TURN 33294 33297 {ECO:0000244|PDB:3QP3}.
STRAND 33299 33305 {ECO:0000244|PDB:3QP3}.
STRAND 33310 33313 {ECO:0000244|PDB:3QP3}.
STRAND 33318 33328 {ECO:0000244|PDB:3QP3}.
STRAND 33331 33336 {ECO:0000244|PDB:3QP3}.
STRAND 33345 33352 {ECO:0000244|PDB:3QP3}.
STRAND 33355 33360 {ECO:0000244|PDB:3QP3}.
HELIX 33365 33367 {ECO:0000244|PDB:3QP3}.
STRAND 33369 33377 {ECO:0000244|PDB:3QP3}.
STRAND 33380 33391 {ECO:0000244|PDB:3QP3}.
STRAND 33489 33492 {ECO:0000244|PDB:1NCT}.
STRAND 33497 33503 {ECO:0000244|PDB:1NCT}.
STRAND 33509 33512 {ECO:0000244|PDB:1NCT}.
STRAND 33514 33516 {ECO:0000244|PDB:1TNM}.
STRAND 33523 33526 {ECO:0000244|PDB:1NCT}.
STRAND 33532 33538 {ECO:0000244|PDB:1NCT}.
STRAND 33540 33547 {ECO:0000244|PDB:1NCT}.
STRAND 33556 33560 {ECO:0000244|PDB:1NCT}.
STRAND 33571 33577 {ECO:0000244|PDB:1NCT}.
STRAND 33777 33783 {ECO:0000244|PDB:3PUC}.
STRAND 33788 33794 {ECO:0000244|PDB:3PUC}.
STRAND 33796 33806 {ECO:0000244|PDB:3PUC}.
STRAND 33809 33814 {ECO:0000244|PDB:3PUC}.
STRAND 33821 33830 {ECO:0000244|PDB:3PUC}.
STRAND 33833 33838 {ECO:0000244|PDB:3PUC}.
HELIX 33843 33845 {ECO:0000244|PDB:3PUC}.
STRAND 33847 33855 {ECO:0000244|PDB:3PUC}.
STRAND 33858 33869 {ECO:0000244|PDB:3PUC}.
STRAND 34254 34258 {ECO:0000244|PDB:3KNB}.
STRAND 34263 34268 {ECO:0000244|PDB:3KNB}.
STRAND 34271 34283 {ECO:0000244|PDB:3KNB}.
STRAND 34286 34291 {ECO:0000244|PDB:3KNB}.
HELIX 34300 34302 {ECO:0000244|PDB:3KNB}.
STRAND 34304 34308 {ECO:0000244|PDB:3KNB}.
STRAND 34310 34319 {ECO:0000244|PDB:3KNB}.
HELIX 34322 34324 {ECO:0000244|PDB:3KNB}.
STRAND 34326 34334 {ECO:0000244|PDB:3KNB}.
STRAND 34337 34348 {ECO:0000244|PDB:3KNB}.
SEQUENCE 34350 AA; 3816030 MW; DEB216410AD560D9 CRC64;
MTTQAPTFTQ PLQSVVVLEG STATFEAHIS GFPVPEVSWF RDGQVISTST LPGVQISFSD
GRAKLTIPAV TKANSGRYSL KATNGSGQAT STAELLVKAE TAPPNFVQRL QSMTVRQGSQ
VRLQVRVTGI PTPVVKFYRD GAEIQSSLDF QISQEGDLYS LLIAEAYPED SGTYSVNATN
SVGRATSTAE LLVQGEEEVP AKKTKTIVST AQISESRQTR IEKKIEAHFD ARSIATVEMV
IDGAAGQQLP HKTPPRIPPK PKSRSPTPPS IAAKAQLARQ QSPSPIRHSP SPVRHVRAPT
PSPVRSVSPA ARISTSPIRS VRSPLLMRKT QASTVATGPE VPPPWKQEGY VASSSEAEMR
ETTLTTSTQI RTEERWEGRY GVQEQVTISG AAGAAASVSA SASYAAEAVA TGAKEVKQDA
DKSAAVATVV AAVDMARVRE PVISAVEQTA QRTTTTAVHI QPAQEQVRKE AEKTAVTKVV
VAADKAKEQE LKSRTKEVIT TKQEQMHVTH EQIRKETEKT FVPKVVISAA KAKEQETRIS
EEITKKQKQV TQEAIRQETE ITAASMVVVA TAKSTKLETV PGAQEETTTQ QDQMHLSYEK
IMKETRKTVV PKVIVATPKV KEQDLVSRGR EGITTKREQV QITQEKMRKE AEKTALSTIA
VATAKAKEQE TILRTRETMA TRQEQIQVTH GKVDVGKKAE AVATVVAAVD QARVREPREP
GHLEESYAQQ TTLEYGYKER ISAAKVAEPP QRPASEPHVV PKAVKPRVIQ APSETHIKTT
DQKGMHISSQ IKKTTDLTTE RLVHVDKRPR TASPHFTVSK ISVPKTEHGY EASIAGSAIA
TLQKELSATS SAQKITKSVK APTVKPSETR VRAEPTPLPQ FPFADTPDTY KSEAGVEVKK
EVGVSITGTT VREERFEVLH GREAKVTETA RVPAPVEIPV TPPTLVSGLK NVTVIEGESV
TLECHISGYP SPTVTWYRED YQIESSIDFQ ITFQSGIARL MIREAFAEDS GRFTCSAVNE
AGTVSTSCYL AVQVSEEFEK ETTAVTEKFT TEEKRFVESR DVVMTDTSLT EEQAGPGEPA
APYFITKPVV QKLVEGGSVV FGCQVGGNPK PHVYWKKSGV PLTTGYRYKV SYNKQTGECK
LVISMTFADD AGEYTIVVRN KHGETSASAS LLEEADYELL MKSQQEMLYQ TQVTAFVQEP
KVGETAPGFV YSEYEKEYEK EQALIRKKMA KDTVVVRTYV EDQEFHISSF EERLIKEIEY
RIIKTTLEEL LEEDGEEKMA VDISESEAVE SGFDSRIKNY RILEGMGVTF HCKMSGYPLP
KIAWYKDGKR IKHGERYQMD FLQDGRASLR IPVVLPEDEG IYTAFASNIK GNAICSGKLY
VEPAAPLGAP TYIPTLEPVS RIRSLSPRSV SRSPIRMSPA RMSPARMSPA RMSPARMSPG
RRLEETDESQ LERLYKPVFV LKPVSFKCLE GQTARFDLKV VGRPMPETFW FHDGQQIVND
YTHKVVIKED GTQSLIIVPA TPSDSGEWTV VAQNRAGRSS ISVILTVEAV EHQVKPMFVE
KLKNVNIKEG SRLEMKVRAT GNPNPDIVWL KNSDIIVPHK YPKIRIEGTK GEAALKIDST
VSQDSAWYTA TAINKAGRDT TRCKVNVEVE FAEPEPERKL IIPRGTYRAK EIAAPELEPL
HLRYGQEQWE EGDLYDKEKQ QKPFFKKKLT SLRLKRFGPA HFECRLTPIG DPTMVVEWLH
DGKPLEAANR LRMINEFGYC SLDYGVAYSR DSGIITCRAT NKYGTDHTSA TLIVKDEKSL
VEESQLPEGR KGLQRIEELE RMAHEGALTG VTTDQKEKQK PDIVLYPEPV RVLEGETARF
RCRVTGYPQP KVNWYLNGQL IRKSKRFRVR YDGIHYLDIV DCKSYDTGEV KVTAENPEGV
IEHKVKLEIQ QREDFRSVLR RAPEPRPEFH VHEPGKLQFE VQKVDRPVDT TETKEVVKLK
RAERITHEKV PEESEELRSK FKRRTEEGYY EAITAVELKS RKKDESYEEL LRKTKDELLH
WTKELTEEEK KALAEEGKIT IPTFKPDKIE LSPSMEAPKI FERIQSQTVG QGSDAHFRVR
VVGKPDPECE WYKNGVKIER SDRIYWYWPE DNVCELVIRD VTAEDSASIM VKAINIAGET
SSHAFLLVQA KQLITFTQEL QDVVAKEKDT MATFECETSE PFVKVKWYKD GMEVHEGDKY
RMHSDRKVHF LSILTIDTSD AEDYSCVLVE DENVKTTAKL IVEGAVVEFV KELQDIEVPE
SYSGELECIV SPENIEGKWY HNDVELKSNG KYTITSRRGR QNLTVKDVTK EDQGEYSFVI
DGKKTTCKLK MKPRPIAILQ GLSDQKVCEG DIVQLEVKVS LESVEGVWMK DGQEVQPSDR
VHIVIDKQSH MLLIEDMTKE DAGNYSFTIP ALGLSTSGRV SVYSVDVITP LKDVNVIEGT
KAVLECKVSV PDVTSVKWYL NDEQIKPDDR VQAIVKGTKQ RLVINRTHAS DEGPYKLIVG
RVETNCNLSV EKIKIIRGLR DLTCTETQNV VFEVELSHSG IDVLWNFKDK EIKPSSKYKI
EAHGKIYKLT VLNMMKDDEG KYTFYAGENM TSGKLTVAGG AISKPLTDQT VAESQEAVFE
CEVANPDSKG EWLRDGKHLP LTNNIRSESD GHKRRLIIAA TKLDDIGEYT YKVATSKTSA
KLKVEAVKIK KTLKNLTVTE TQDAVFTVEL THPNVKGVQW IKNGVVLESN EKYAISVKGT
IYSLRIKNCA IVDESVYGFR LGRLGASARL HVETVKIIKK PKDVTALENA TVAFEVSVSH
DTVPVKWFHK SVEIKPSDKH RLVSERKVHK LMLQNISPSD AGEYTAVVGQ LECKAKLFVE
TLHITKTMKN IEVPETKTAS FECEVSHFNV PSMWLKNGVE IEMSEKFKIV VQGKLHQLII
MNTSTEDSAE YTFVCGNDQV SATLTVTPIM ITSMLKDINA EEKDTITFEV TVNYEGISYK
WLKNGVEIKS TDKCQMRTKK LTHSLNIRNV HFGDAADYTF VAGKATSTAT LYVEARHIEF
RKHIKDIKVL EKKRAMFECE VSEPDITVQW MKDDQELQIT DRIKIQKEKY VHRLLIPSTR
MSDAGKYTVV AGGNVSTAKL FVEGRDVRIR SIKKEVQVIE KQRAVVEFEV NEDDVDAHWY
KDGIEINFQV QERHKYVVER RIHRMFISET RQSDAGEYTF VAGRNRSSVT LYVNAPEPPQ
VLQELQPVTV QSGKPARFCA VISGRPQPKI SWYKEEQLLS TGFKCKFLHD GQEYTLLLIE
AFPEDAAVYT CEAKNDYGVA TTSASLSVEV PEVVSPDQEM PVYPPAIITP LQDTVTSEGQ
PARFQCRVSG TDLKVSWYSK DKKIKPSRFF RMTQFEDTYQ LEIAEAYPED EGTYTFVASN
AVGQVSSTAN LSLEAPESIL HERIEQEIEM EMKEFSSSFL SAEEEGLHSA ELQLSKINET
LELLSESPVY PTKFDSEKEG TGPIFIKEVS NADISMGDVA TLSVTVIGIP KPKIQWFFNG
VLLTPSADYK FVFDGDDHSL IILFTKLEDE GEYTCMASND YGKTICSAYL KINSKGEGHK
DTETESAVAK SLEKLGGPCP PHFLKELKPI RCAQGLPAIF EYTVVGEPAP TVTWFKENKQ
LCTSVYYTII HNPNGSGTFI VNDPQREDSG LYICKAENML GESTCAAELL VLLEDTDMTD
TPCKAKSTPE APEDFPQTPL KGPAVEALDS EQEIATFVKD TILKAALITE ENQQLSYEHI
AKANELSSQL PLGAQELQSI LEQDKLTPES TREFLCINGS IHFQPLKEPS PNLQLQIVQS
QKTFSKEGIL MPEEPETQAV LSDTEKIFPS AMSIEQINSL TVEPLKTLLA EPEGNYPQSS
IEPPMHSYLT SVAEEVLSPK EKTVSDTNRE QRVTLQKQEA QSALILSQSL AEGHVESLQS
PDVMISQVNY EPLVPSEHSC TEGGKILIES ANPLENAGQD SAVRIEEGKS LRFPLALEEK
QVLLKEEHSD NVVMPPDQII ESKREPVAIK KVQEVQGRDL LSKESLLSGI PEEQRLNLKI
QICRALQAAV ASEQPGLFSE WLRNIEKVEV EAVNITQEPR HIMCMYLVTS AKSVTEEVTI
IIEDVDPQMA NLKMELRDAL CAIIYEEIDI LTAEGPRIQQ GAKTSLQEEM DSFSGSQKVE
PITEPEVESK YLISTEEVSY FNVQSRVKYL DATPVTKGVA SAVVSDEKQD ESLKPSEEKE
ESSSESGTEE VATVKIQEAE GGLIKEDGPM IHTPLVDTVS EEGDIVHLTT SITNAKEVNW
YFENKLVPSD EKFKCLQDQN TYTLVIDKVN TEDHQGEYVC EALNDSGKTA TSAKLTVVKR
AAPVIKRKIE PLEVALGHLA KFTCEIQSAP NVRFQWFKAG REIYESDKCS IRSSKYISSL
EILRTQVVDC GEYTCKASNE YGSVSCTATL TVTEAYPPTF LSRPKSLTTF VGKAAKFICT
VTGTPVIETI WQKDGAALSP SPNWRISDAE NKHILELSNL TIQDRGVYSC KASNKFGADI
CQAELIIIDK PHFIKELEPV QSAINKKVHL ECQVDEDRKV TVTWSKDGQK LPPGKDYKIC
FEDKIATLEI PLAKLKDSGT YVCTASNEAG SSSCSATVTV REPPSFVKKV DPSYLMLPGE
SARLHCKLKG SPVIQVTWFK NNKELSESNT VRMYFVNSEA ILDITDVKVE DSGSYSCEAV
NDVGSDSCST EIVIKEPPSF IKTLEPADIV RGTNALLQCE VSGTGPFEIS WFKDKKQIRS
SKKYRLFSQK SLVCLEIFSF NSADVGEYEC VVANEVGKCG CMATHLLKEP PTFVKKVDDL
IALGGQTVTL QAAVRGSEPI SVTWMKGQEV IREDGKIKMS FSNGVAVLII PDVQISFGGK
YTCLAENEAG SQTSVGELIV KEPAKIIERA ELIQVTAGDP ATLEYTVAGT PELKPKWYKD
GRPLVASKKY RISFKNNVAQ LKFYSAELHD SGQYTFEISN EVGSSSCETT FTVLDRDIAP
FFTKPLRNVD SVVNGTCRLD CKIAGSLPMR VSWFKDGKEI AASDRYRIAF VEGTASLEII
RVDMNDAGNF TCRATNSVGS KDSSGALIVQ EPPSFVTKPG SKDVLPGSAV CLKSTFQGST
PLTIRWFKGN KELVSGGSCY ITKEALESSL ELYLVKTSDS GTYTCKVSNV AGGVECSANL
FVKEPATFVE KLEPSQLLKK GDATQLACKV TGTPPIKITW FANDREIKES SKHRMSFVES
TAVLRLTDVG IEDSGEYMCE AQNEAGSDHC SSIVIVKESP YFTKEFKPIE VLKEYDVMLL
AEVAGTPPFE ITWFKDNTIL RSGRKYKTFI QDHLVSLQIL KFVAADAGEY QCRVTNEVGS
SICSARVTLR EPPSFIKKIE STSSLRGGTA AFQATLKGSL PITVTWLKDS DEITEDDNIR
MTFENNVASL YLSGIEVKHD GKYVCQAKND AGIQRCSALL SVKEPATITE EAVSIDVTQG
DPATLQVKFS GTKEITAKWF KDGQELTLGS KYKISVTDTV SILKIISTEK KDSGEYTFEV
QNDVGRSSCK ARINVLDLII PPSFTKKLKK MDSIKGSFID LECIVAGSHP ISIQWFKDDQ
EISASEKYKF SFHDNTAFLE ISQLEGTDSG TYTCSATNKA GHNQCSGHLT VKEPPYFVEK
PQSQDVNPNT RVQLKALVGG TAPMTIKWFK DNKELHSGAA RSVWKDDTST SLELFAAKAT
DSGTYICQLS NDVGTATSKA TLFVKEPPQF IKKPSPVLVL RNGQSTTFEC QITGTPKIRV
SWYLDGNEIT AIQKHGISFI DGLATFQISG ARVENSGTYV CEARNDAGTA SCSIELKVKE
PPTFIRELKP VEVVKYSDVE LECEVTGTPP FEVTWLKNNR EIRSSKKYTL TDRVSVFNLH
ITKCDPSDTG EYQCIVSNEG GSCSCSTRVA LKEPPSFIKK IENTTTVLKS SATFQSTVAG
SPPISITWLK DDQILDEDDN VYISFVDSVA TLQIRSVDNG HSGRYTCQAK NESGVERCYA
FLLVQEPAQI VEKAKSVDVT EKDPMTLECV VAGTPELKVK WLKDGKQIVP SRYFSMSFEN
NVASFRIQSV MKQDSGQYTF KVENDFGSSS CDAYLRVLDQ NIPPSFTKKL TKMDKVLGSS
IHMECKVSGS LPISAQWFKD GKEISTSAKY RLVCHERSVS LEVNNLELED TANYTCKVSN
VAGDDACSGI LTVKEPPSFL VKPGRQQAIP DSTVEFKAIL KGTPPFKIKW FKDDVELVSG
PKCFIGLEGS TSFLNLYSVD ASKTGQYTCH VTNDVGSDSC TTMLLVTEPP KFVKKLEASK
IVKAGDSSRL ECKIAGSPEI RVVWFRNEHE LPASDKYRMT FIDSVAVIQM NNLSTEDSGD
FICEAQNPAG STSCSTKVIV KEPPVFSSFP PIVETLKNAE VSLECELSGT PPFEVVWYKD
KRQLRSSKKY KIASKNFHTS IHILNVDTSD IGEYHCKAQN EVGSDTCVCT VKLKEPPRFV
SKLNSLTVVA GEPAELQASI EGAQPIFVQW LKEKEEVIRE SENIRITFVE NVATLQFAKA
EPANAGKYIC QIKNDGGMRE NMATLMVLEP AVIVEKAGPM TVTVGETCTL ECKVAGTPEL
SVEWYKDGKL LTSSQKHKFS FYNKISSLRI LSVERQDAGT YTFQVQNNVG KSSCTAVVDV
SDRAVPPSFT RRLKNTGGVL GASCILECKV AGSSPISVAW FHEKTKIVSG AKYQTTFSDN
VCTLQLNSLD SSDMGNYTCV AANVAGSDEC RAVLTVQEPP SFVKEPEPLE VLPGKNVTFT
SVIRGTPPFK VNWFRGAREL VKGDRCNIYF EDTVAELELF NIDISQSGEY TCVVSNNAGQ
ASCTTRLFVK EPAAFLKRLS DHSVEPGKSI ILESTYTGTL PISVTWKKDG FNITTSEKCN
IVTTEKTCIL EILNSTKRDA GQYSCEIENE AGRDVCGALV STLEPPYFVT ELEPLEAAVG
DSVSLQCQVA GTPEITVSWY KGDTKLRPTP EYRTYFTNNV ATLVFNKVNI NDSGEYTCKA
ENSIGTASSK TVFRIQERQL PPSFARQLKD IEQTVGLPVT LTCRLNGSAP IQVCWYRDGV
LLRDDENLQT SFVDNVATLK ILQTDLSHSG QYSCSASNPL GTASSSARLT AREPKKSPFF
DIKPVSIDVI AGESADFECH VTGAQPMRIT WSKDNKEIRP GGNYTITCVG NTPHLRILKV
GKGDSGQYTC QATNDVGKDM CSAQLSVKEP PKFVKKLEAS KVAKQGESIQ LECKISGSPE
IKVSWFRNDS ELHESWKYNM SFINSVALLT INEASAEDSG DYICEAHNGV GDASCSTALT
VKAPPVFTQK PSPVGALKGS DVILQCEISG TPPFEVVWVK DRKQVRNSKK FKITSKHFDT
SLHILNLEAS DVGEYHCKAT NEVGSDTCSC SVKFKEPPRF VKKLSDTSTL IGDAVELRAI
VEGFQPISVV WLKDRGEVIR ESENTRISFI DNIATLQLGS PEASNSGKYI CQIKNDAGMR
ECSAVLTVLE PARIIEKPEP MTVTTGNPFA LECVVTGTPE LSAKWFKDGR ELSADSKHHI
TFINKVASLK IPCAEMSDKG LYSFEVKNSV GKSNCTVSVH VSDRIVPPSF IRKLKDVNAI
LGASVVLECR VSGSAPISVG WFQDGNEIVS GPKCQSSFSE NVCTLNLSLL EPSDTGIYTC
VAANVAGSDE CSAVLTVQEP PSFEQTPDSV EVLPGMSLTF TSVIRGTPPF KVKWFKGSRE
LVPGESCNIS LEDFVTELEL FEVQPLESGD YSCLVTNDAG SASCTTHLFV KEPATFVKRL
ADFSVETGSP IVLEATYTGT PPISVSWIKD EYLISQSERC SITMTEKSTI LEILESTIED
YAQYSCLIEN EAGQDICEAL VSVLEPPYFI EPLEHVEAVI GEPATLQCKV DGTPEIRISW
YKEHTKLRSA PAYKMQFKNN VASLVINKVD HSDVGEYSCK ADNSVGAVAS SAVLVIKARK
LPPFFARKLK DVHETLGFPV AFECRINGSE PLQVSWYKDG VLLKDDANLQ TSFVHNVATL
QILQTDQSHI GQYNCSASNP LGTASSSAKL ILSEHEVPPF FDLKPVSVDL ALGESGTFKC
HVTGTAPIKI TWAKDNREIR PGGNYKMTLV ENTATLTVLK VGKGDAGQYT CYASNIAGKD
SCSAQLGVQE PPRFIKKLEP SRIVKQDEFT RYECKIGGSP EIKVLWYKDE TEIQESSKFR
MSFVDSVAVL EMHNLSVEDS GDYTCEAHNA AGSASSSTSL KVKEPPIFRK KPHPIETLKG
ADVHLECELQ GTPPFHVSWY KDKRELRSGK KYKIMSENFL TSIHILNVDA ADIGEYQCKA
TNDVGSDTCV GSIALKAPPR FVKKLSDIST VVGKEVQLQT TIEGAEPISV VWFKDKGEIV
RESDNIWISY SENIATLQFS RVEPANAGKY TCQIKNDAGM QECFATLSVL EPATIVEKPE
SIKVTTGDTC TLECTVAGTP ELSTKWFKDG KELTSDNKYK ISFFNKVSGL KIINVAPSDS
GVYSFEVQNP VGKDSCTASL QVSDRTVPPS FTRKLKETNG LSGSSVVMEC KVYGSPPISV
SWFHEGNEIS SGRKYQTTLT DNTCALTVNM LEESDSGDYT CIATNMAGSD ECSAPLTVRE
PPSFVQKPDP MDVLTGTNVT FTSIVKGTPP FSVSWFKGSS ELVPGDRCNV SLEDSVAELE
LFDVDTSQSG EYTCIVSNEA GKASCTTHLY IKAPAKFVKR LNDYSIEKGK PLILEGTFTG
TPPISVTWKK NGINVTPSQR CNITTTEKSA ILEIPSSTVE DAGQYNCYIE NASGKDSCSA
QILILEPPYF VKQLEPVKVS VGDSASLQCQ LAGTPEIGVS WYKGDTKLRP TTTYKMHFRN
NVATLVFNQV DINDSGEYIC KAENSVGEVS ASTFLTVQEQ KLPPSFSRQL RDVQETVGLP
VVFDCAISGS EPISVSWYKD GKPLKDSPNV QTSFLDNTAT LNIFKTDRSL AGQYSCTATN
PIGSASSSAR LILTEGKNPP FFDIRLAPVD AVVGESADFE CHVTGTQPIK VSWAKDSREI
RSGGKYQISY LENSAHLTVL KVDKGDSGQY TCYAVNEVGK DSCTAQLNIK ERLIPPSFTK
RLSETVEETE GNSFKLEGRV AGSQPITVAW YKNNIEIQPT SNCEITFKNN TLVLQVRKAG
MNDAGLYTCK VSNDAGSALC TSSIVIKEPK KPPVFDQHLT PVTVSEGEYV QLSCHVQGSE
PIRIQWLKAG REIKPSDRCS FSFASGTAVL ELRDVAKADS GDYVCKASNV AGSDTTKSKV
TIKDKPAVAP ATKKAAVDGR LFFVSEPQSI RVVEKTTATF IAKVGGDPIP NVKWTKGKWR
QLNQGGRVFI HQKGDEAKLE IRDTTKTDSG LYRCVAFNEH GEIESNVNLQ VDERKKQEKI
EGDLRAMLKK TPILKKGAGE EEEIDIMELL KNVDPKEYEK YARMYGITDF RGLLQAFELL
KQSQEEETHR LEIEEIERSE RDEKEFEELV SFIQQRLSQT EPVTLIKDIE NQTVLKDNDA
VFEIDIKINY PEIKLSWYKG TEKLEPSDKF EISIDGDRHT LRVKNCQLKD QGNYRLVCGP
HIASAKLTVI EPAWERHLQD VTLKEGQTCT MTCQFSVPNV KSEWFRNGRI LKPQGRHKTE
VEHKVHKLTI ADVRAEDQGQ YTCKYEDLET SAELRIEAEP IQFTKRIQNI VVSEHQSATF
ECEVSFDDAI VTWYKGPTEL TESQKYNFRN DGRCHYMTIH NVTPDDEGVY SVIARLEPRG
EARSTAELYL TTKEIKLELK PPDIPDSRVP IPTMPIRAVP PEEIPPVVAP PIPLLLPTPE
EKKPPPKRIE VTKKAVKKDA KKVVAKPKEM TPREEIVKKP PPPTTLIPAK APEIIDVSSK
AEEVKIMTIT RKKEVQKEKE AVYEKKQAVH KEKRVFIESF EEPYDELEVE PYTEPFEQPY
YEEPDEDYEE IKVEAKKEVH EEWEEDFEEG QEYYEREEGY DEGEEEWEEA YQEREVIQVQ
KEVYEESHER KVPAKVPEKK APPPPKVIKK PVIEKIEKTS RRMEEEKVQV TKVPEVSKKI
VPQKPSRTPV QEEVIEVKVP AVHTKKMVIS EEKMFFASHT EEEVSVTVPE VQKEIVTEEK
IHVAISKRVE PPPKVPELPE KPAPEEVAPV PIPKKVEPPA PKVPEVPKKP VPEEKKPVPV
PKKEPAAPPK VPEVPKKPVP EEKIPVPVAK KKEAPPAKVP EVQKGVVTEE KITIVTQREE
SPPPAVPEIP KKKVPEERKP VPRKEEEVPP PPKVPALPKK PVPEEKVAVP VPVAKKAPPP
RAEVSKKTVV EEKRFVAEEK LSFAVPQRVE VTRHEVSAEE EWSYSEEEEG VSISVYREEE
REEEEEAEVT EYEVMEEPEE YVVEEKLHII SKRVEAEPAE VTERQEKKIV LKPKIPAKIE
EPPPAKVPEA PKKIVPEKKV PAPVPKKEKV PPPKVPEEPK KPVPEKKVPP KVIKMEEPLP
AKVTERHMQI TQEEKVLVAV TKKEAPPKAR VPEEPKRAVP EEKVLKLKPK REEEPPAKVT
EFRKRVVKEE KVSIEAPKRE PQPIKEVTIM EEKERAYTLE EEAVSVQREE EYEEYEEYDY
KEFEEYEPTE EYDQYEEYEE REYERYEEHE EYITEPEKPI PVKPVPEEPV PTKPKAPPAK
VLKKAVPEEK VPVPIPKKLK PPPPKVPEEP KKVFEEKIRI SITKREKEQV TEPAAKVPMK
PKRVVAEEKV PVPRKEVAPP VRVPEVPKEL EPEEVAFEEE VVTHVEEYLV EEEEEYIHEE
EEFITEEEVV PVIPVKVPEV PRKPVPEEKK PVPVPKKKEA PPAKVPEVPK KPEEKVPVLI
PKKEKPPPAK VPEVPKKPVP EEKVPVPVPK KVEAPPAKVP EVPKKPVPEK KVPVPAPKKV
EAPPAKVPEV PKKLIPEEKK PTPVPKKVEA PPPKVPKKRE PVPVPVALPQ EEEVLFEEEI
VPEEEVLPEE EEVLPEEEEV LPEEEEVLPE EEEIPPEEEE VPPEEEYVPE EEEFVPEEEV
LPEVKPKVPV PAPVPEIKKK VTEKKVVIPK KEEAPPAKVP EVPKKVEEKR IILPKEEEVL
PVEVTEEPEE EPISEEEIPE EPPSIEEVEE VAPPRVPEVI KKAVPEAPTP VPKKVEAPPA
KVSKKIPEEK VPVPVQKKEA PPAKVPEVPK KVPEKKVLVP KKEAVPPAKG RTVLEEKVSV
AFRQEVVVKE RLELEVVEAE VEEIPEEEEF HEVEEYFEEG EFHEVEEFIK LEQHRVEEEH
RVEKVHRVIE VFEAEEVEVF EKPKAPPKGP EISEKIIPPK KPPTKVVPRK EPPAKVPEVP
KKIVVEEKVR VPEEPRVPPT KVPEVLPPKE VVPEKKVPVP PAKKPEAPPP KVPEAPKEVV
PEKKVPVPPP KKPEVPPTKV PEVPKAAVPE KKVPEAIPPK PESPPPEVPE APKEVVPEKK
VPAAPPKKPE VTPVKVPEAP KEVVPEKKVP VPPPKKPEVP PTKVPEVPKV AVPEKKVPEA
IPPKPESPPP EVFEEPEEVA LEEPPAEVVE EPEPAAPPQV TVPPKKPVPE KKAPAVVAKK
PELPPVKVPE VPKEVVPEKK VPLVVPKKPE APPAKVPEVP KEVVPEKKVA VPKKPEVPPA
KVPEVPKKPV LEEKPAVPVP ERAESPPPEV YEEPEEIAPE EEIAPEEEKP VPVAEEEEPE
VPPPAVPEEP KKIIPEKKVP VIKKPEAPPP KEPEPEKVIE KPKLKPRPPP PPPAPPKEDV
KEKIFQLKAI PKKKVPEKPQ VPEKVELTPL KVPGGEKKVR KLLPERKPEP KEEVVLKSVL
RKRPEEEEPK VEPKKLEKVK KPAVPEPPPP KPVEEVEVPT VTKRERKIPE PTKVPEIKPA
IPLPAPEPKP KPEAEVKTIK PPPVEPEPTP IAAPVTVPVV GKKAEAKAPK EEAAKPKGPI
KGVPKKTPSP IEAERRKLRP GSGGEKPPDE APFTYQLKAV PLKFVKEIKD IILTESEFVG
SSAIFECLVS PSTAITTWMK DGSNIRESPK HRFIADGKDR KLHIIDVQLS DAGEYTCVLR
LGNKEKTSTA KLVVEELPVR FVKTLEEEVT VVKGQPLYLS CELNKERDVV WRKDGKIVVE
KPGRIVPGVI GLMRALTIND ADDTDAGTYT VTVENANNLE CSSCVKVVEV IRDWLVKPIR
DQHVKPKGTA IFACDIAKDT PNIKWFKGYD EIPAEPNDKT EILRDGNHLY LKIKNAMPED
IAEYAVEIEG KRYPAKLTLG EREVELLKPI EDVTIYEKES ASFDAEISEA DIPGQWKLKG
ELLRPSPTCE IKAEGGKRFL TLHKVKLDQA GEVLYQALNA ITTAILTVKE IELDFAVPLK
DVTVPERRQA RFECVLTREA NVIWSKGPDI IKSSDKFDII ADGKKHILVI NDSQFDDEGV
YTAEVEGKKT SARLFVTGIR LKFMSPLEDQ TVKEGETATF VCELSHEKMH VVWFKNDAKL
HTSRTVLISS EGKTHKLEMK EVTLDDISQI KAQVKELSST AQLKVLEADP YFTVKLHDKT
AVEKDEITLK CEVSKDVPVK WFKDGEEIVP SPKYSIKADG LRRILKIKKA DLKDKGEYVC
DCGTDKTKAN VTVEARLIKV EKPLYGVEVF VGETAHFEIE LSEPDVHGQW KLKGQPLTAS
PDCEIIEDGK KHILILHNCQ LGMTGEVSFQ AANAKSAANL KVKELPLIFI TPLSDVKVFE
KDEAKFECEV SREPKTFRWL KGTQEITGDD RFELIKDGTK HSMVIKSAAF EDEAKYMFEA
EDKHTSGKLI IEGIRLKFLT PLKDVTAKEK ESAVFTVELS HDNIRVKWFK NDQRLHTTRS
VSMQDEGKTH SITFKDLSID DTSQIRVEAM GMSSEAKLTV LEGDPYFTGK LQDYTGVEKD
EVILQCEISK ADAPVKWFKD GKEIKPSKNA VIKADGKKRM LILKKALKSD IGQYTCDCGT
DKTSGKLDIE DREIKLVRPL HSVEVMETET ARFETEISED DIHANWKLKG EALLQTPDCE
IKEEGKIHSL VLHNCRLDQT GGVDFQAANV KSSAHLRVKP RVIGLLRPLK DVTVTAGETA
TFDCELSYED IPVEWYLKGK KLEPSDKVVP RSEGKVHTLT LRDVKLEDAG EVQLTAKDFK
THANLFVKEP PVEFTKPLED QTVEEGATAV LECEVSRENA KVKWFKNGTE ILKSKKYEIV
ADGRVRKLVI HDCTPEDIKT YTCDAKDFKT SCNLNVVPPH VEFLRPLTDL QVREKEMARF
ECELSRENAK VKWFKDGAEI KKGKKYDIIS KGAVRILVIN KCLLDDEAEY SCEVRTARTS
GMLTVLEEEA VFTKNLANIE VSETDTIKLV CEVSKPGAEV IWYKGDEEII ETGRYEILTE
GRKRILVIQN AHLEDAGNYN CRLPSSRTDG KVKVHELAAE FISKPQNLEI LEGEKAEFVC
SISKESFPVQ WKRDDKTLES GDKYDVIADG KKRVLVVKDA TLQDMGTYVV MVGAARAAAH
LTVIEKLRIV VPLKDTRVKE QQEVVFNCEV NTEGAKAKWF RNEEAIFDSS KYIILQKDLV
YTLRIRDAHL DDQANYNVSL TNHRGENVKS AANLIVEEED LRIVEPLKDI ETMEKKSVTF
WCKVNRLNVT LKWTKNGEEV PFDNRVSYRV DKYKHMLTIK DCGFPDEGEY IVTAGQDKSV
AELLIIEAPT EFVEHLEDQT VTEFDDAVFS CQLSREKANV KWYRNGREIK EGKKYKFEKD
GSIHRLIIKD CRLDDECEYA CGVEDRKSRA RLFVEEIPVE IIRPPQDILE APGADVVFLA
ELNKDKVEVQ WLRNNMVVVQ GDKHQMMSEG KIHRLQICDI KPRDQGEYRF IAKDKEARAK
LELAAAPKIK TADQDLVVDV GKPLTMVVPY DAYPKAEAEW FKENEPLSTK TIDTTAEQTS
FRILEAKKGD KGRYKIVLQN KHGKAEGFIN LKVIDVPGPV RNLEVTETFD GEVSLAWEEP
LTDGGSKIIG YVVERRDIKR KTWVLATDRA ESCEFTVTGL QKGGVEYLFR VSARNRVGTG
EPVETDNPVE ARSKYDVPGP PLNVTITDVN RFGVSLTWEP PEYDGGAEIT NYVIELRDKT
SIRWDTAMTV RAEDLSATVT DVVEGQEYSF RVRAQNRIGV GKPSAATPFV KVADPIERPS
PPVNLTSSDQ TQSSVQLKWE PPLKDGGSPI LGYIIERCEE GKDNWIRCNM KLVPELTYKV
TGLEKGNKYL YRVSAENKAG VSDPSEILGP LTADDAFVEP TMDLSAFKDG LEVIVPNPIT
ILVPSTGYPR PTATWCFGDK VLETGDRVKM KTLSAYAELV ISPSERSDKG IYTLKLENRV
KTISGEIDVN VIARPSAPKE LKFGDITKDS VHLTWEPPDD DGGSPLTGYV VEKREVSRKT
WTKVMDFVTD LEFTVPDLVQ GKEYLFKVCA RNKCGPGEPA YVDEPVNMST PATVPDPPEN
VKWRDRTANS IFLTWDPPKN DGGSRIKGYI VERCPRGSDK WVACGEPVAE TKMEVTGLEE
GKWYAYRVKA LNRQGASKPS RPTEEIQAVD TQEAPEIFLD VKLLAGLTVK AGTKIELPAT
VTGKPEPKIT WTKADMILKQ DKRITIENVP KKSTVTIVDS KRSDTGTYII EAVNVCGRAT
AVVEVNVLDK PGPPAAFDIT DVTNESCLLT WNPPRDDGGS KITNYVVERR ATDSEVWHKL
SSTVKDTNFK ATKLIPNKEY IFRVAAENMY GVGEPVQASP ITAKYQFDPP GPPTRLEPSD
ITKDAVTLTW CEPDDDGGSP ITGYWVERLD PDTDKWVRCN KMPVKDTTYR VKGLTNKKKY
RFRVLAENLA GPGKPSKSTE PILIKDPIDP PWPPGKPTVK DVGKTSVRLN WTKPEHDGGA
KIESYVIEML KTGTDEWVRV AEGVPTTQHL LPGLMEGQEY SFRVRAVNKA GESEPSEPSD
PVLCREKLYP PSPPRWLEVI NITKNTADLK WTVPEKDGGS PITNYIVEKR DVRRKGWQTV
DTTVKDTKCT VTPLTEGSLY VFRVAAENAI GQSDYTEIED SVLAKDTFTT PGPPYALAVV
DVTKRHVDLK WEPPKNDGGR PIQRYVIEKK ERLGTRWVKA GKTAGPDCNF RVTDVIEGTE
VQFQVRAENE AGVGHPSEPT EILSIEDPTS PPSPPLDLHV TDAGRKHIAI AWKPPEKNGG
SPIIGYHVEM CPVGTEKWMR VNSRPIKDLK FKVEEGVVPD KEYVLRVRAV NAIGVSEPSE
ISENVVAKDP DCKPTIDLET HDIIVIEGEK LSIPVPFRAV PVPTVSWHKD GKEVKASDRL
TMKNDHISAH LEVPKSVRAD AGIYTITLEN KLGSATASIN VKVIGLPGPC KDIKASDITK
SSCKLTWEPP EFDGGTPILH YVLERREAGR RTYIPVMSGE NKLSWTVKDL IPNGEYFFRV
KAVNKVGGGE YIELKNPVIA QDPKQPPDPP VDVEVHNPTA EAMTITWKPP LYDGGSKIMG
YIIEKIAKGE ERWKRCNEHL VPILTYTAKG LEEGKEYQFR VRAENAAGIS EPSRATPPTK
AVDPIDAPKV ILRTSLEVKR GDEIALDASI SGSPYPTITW IKDENVIVPE EIKKRAAPLV
RRRKGEVQEE EPFVLPLTQR LSIDNSKKGE SQLRVRDSLR PDHGLYMIKV ENDHGIAKAP
CTVSVLDTPG PPINFVFEDI RKTSVLCKWE PPLDDGGSEI INYTLEKKDK TKPDSEWIVV
TSTLRHCKYS VTKLIEGKEY LFRVRAENRF GPGPPCVSKP LVAKDPFGPP DAPDKPIVED
VTSNSMLVKW NEPKDNGSPI LGYWLEKREV NSTHWSRVNK SLLNALKANV DGLLEGLTYV
FRVCAENAAG PGKFSPPSDP KTAHDPISPP GPPIPRVTDT SSTTIELEWE PPAFNGGGEI
VGYFVDKQLV GTNEWSRCTE KMIKVRQYTV KEIREGADYK LRVSAVNAAG EGPPGETQPV
TVAEPQEPPA VELDVSVKGG IQIMAGKTLR IPAVVTGRPV PTKVWTKEEG ELDKDRVVID
NVGTKSELII KDALRKDHGR YVITATNSCG SKFAAARVEV FDVPGPVLDL KPVVTNRKMC
LLNWSDPEDD GGSEITGFII ERKDAKMHTW RQPIETERSK CDITGLLEGQ EYKFRVIAKN
KFGCGPPVEI GPILAVDPLG PPTSPERLTY TERTKSTITL DWKEPRSNGG SPIQGYIIEK
RRHDKPDFER VNKRLCPTTS FLVENLDEHQ MYEFRVKAVN EIGESEPSLP LNVVIQDDEV
PPTIKLRLSV RGDTIKVKAG EPVHIPADVT GLPMPKIEWS KNETVIEKPT DALQITKEEV
SRSEAKTELS IPKAVREDKG TYTVTASNRL GSVFRNVHVE VYDRPSPPRN LAVTDIKAES
CYLTWDAPLD NGGSEITHYV IDKRDASRKK AEWEEVTNTA VEKRYGIWKL IPNGQYEFRV
RAVNKYGISD ECKSDKVVIQ DPYRLPGPPG KPKVLARTKG SMLVSWTPPL DNGGSPITGY
WLEKREEGSP YWSRVSRAPI TKVGLKGVEF NVPRLLEGVK YQFRAMAINA AGIGPPSEPS
DPEVAGDPIF PPGPPSCPEV KDKTKSSISL GWKPPAKDGG SPIKGYIVEM QEEGTTDWKR
VNEPDKLITT CECVVPNLKE LRKYRFRVKA VNEAGESEPS DTTGEIPATD IQEEPEVFID
IGAQDCLVCK AGSQIRIPAV IKGRPTPKSS WEFDGKAKKA MKDGVHDIPE DAQLETAENS
SVIIIPECKR SHTGKYSITA KNKAGQKTAN CRVKVMDVPG PPKDLKVSDI TRGSCRLSWK
MPDDDGGDRI KGYVIEKRTI DGKAWTKVNP DCGSTTFVVP DLLSEQQYFF RVRAENRFGI
GPPVETIQRT TARDPIYPPD PPIKLKIGLI TKNTVHLSWK PPKNDGGSPV THYIVECLAW
DPTGTKKEAW RQCNKRDVEE LQFTVEDLVE GGEYEFRVKA VNAAGVSKPS ATVGPVTVKD
QTCPPSIDLK EFMEVEEGTN VNIVAKIKGV PFPTLTWFKA PPKKPDNKEP VLYDTHVNKL
VVDDTCTLVI PQSRRSDTGL YTITAVNNLG TASKEMRLNV LGRPGPPVGP IKFESVSADQ
MTLSWFPPKD DGGSKITNYV IEKREANRKT WVHVSSEPKE CTYTIPKLLE GHEYVFRIMA
QNKYGIGEPL DSEPETARNL FSVPGAPDKP TVSSVTRNSM TVNWEEPEYD GGSPVTGYWL
EMKDTTSKRW KRVNRDPIKA MTLGVSYKVT GLIEGSDYQF RVYAINAAGV GPASLPSDPA
TARDPIAPPG PPFPKVTDWT KSSADLEWSP PLKDGGSKVT GYIVEYKEEG KEEWEKGKDK
EVRGTKLVVT GLKEGAFYKF RVRAVNIAGI GEPGEVTDVI EMKDRLVSPD LQLDASVRDR
IVVHAGGVIR IIAYVSGKPP PTVTWNMNER TLPQEATIET TAISSSMVIK NCQRSHQGVY
SLLAKNEAGE RKKTIIVDVL DVPGPVGTPF LAHNLTNESC KLTWFSPEDD GGSPITNYVI
EKRESDRRAW TPVTYTVTRQ NATVQGLIQG KAYFFRIAAE NSIGMGPFVE TSEALVIREP
ITVPERPEDL EVKEVTKNTV TLTWNPPKYD GGSEIINYVL ESRLIGTEKF HKVTNDNLLS
RKYTVKGLKE GDTYEYRVSA VNIVGQGKPS FCTKPITCKD ELAPPTLHLD FRDKLTIRVG
EAFALTGRYS GKPKPKVSWF KDEADVLEDD RTHIKTTPAT LALEKIKAKR SDSGKYCVVV
ENSTGSRKGF CQVNVVDRPG PPVGPVSFDE VTKDYMVISW KPPLDDGGSK ITNYIIEKKE
VGKDVWMPVT SASAKTTCKV SKLLEGKDYI FRIHAENLYG ISDPLVSDSM KAKDRFRVPD
APDQPIVTEV TKDSALVTWN KPHDGGKPIT NYILEKRETM SKRWARVTKD PIHPYTKFRV
PDLLEGCQYE FRVSAENEIG IGDPSPPSKP VFAKDPIAKP SPPVNPEAID TTCNSVDLTW
QPPRHDGGSK ILGYIVEYQK VGDEEWRRAN HTPESCPETK YKVTGLRDGQ TYKFRVLAVN
AAGESDPAHV PEPVLVKDRL EPPELILDAN MAREQHIKVG DTLRLSAIIK GVPFPKVTWK
KEDRDAPTKA RIDVTPVGSK LEIRNAAHED GGIYSLTVEN PAGSKTVSVK VLVLDKPGPP
RDLEVSEIRK DSCYLTWKEP LDDGGSVITN YVVERRDVAS AQWSPLSATS KKKSHFAKHL
NEGNQYLFRV AAENQYGRGP FVETPKPIKA LDPLHPPGPP KDLHHVDVDK TEVSLVWNKP
DRDGGSPITG YLVEYQEEGT QDWIKFKTVT NLECVVTGLQ QGKTYRFRVK AENIVGLGLP
DTTIPIECQE KLVPPSVELD VKLIEGLVVK AGTTVRFPAI IRGVPVPTAK WTTDGSEIKT
DEHYTVETDN FSSVLTIKNC LRRDTGEYQI TVSNAAGSKT VAVHLTVLDV PGPPTGPINI
LDVTPEHMTI SWQPPKDDGG SPVINYIVEK QDTRKDTWGV VSSGSSKTKL KIPHLQKGCE
YVFRVRAENK IGVGPPLDST PTVAKHKFSP PSPPGKPVVT DITENAATVS WTLPKSDGGS
PITGYYMERR EVTGKWVRVN KTPIADLKFR VTGLYEGNTY EFRVFAENLA GLSKPSPSSD
PIKACRPIKP PGPPINPKLK DKSRETADLV WTKPLSDGGS PILGYVVECQ KPGTAQWNRI
NKDELIRQCA FRVPGLIEGN EYRFRIKAAN IVGEGEPREL AESVIAKDIL HPPEVELDVT
CRDVITVRVG QTIRILARVK GRPEPDITWT KEGKVLVREK RVDLIQDLPR VELQIKEAVR
ADHGKYIISA KNSSGHAQGS AIVNVLDRPG PCQNLKVTNV TKENCTISWE NPLDNGGSEI
TNFIVEYRKP NQKGWSIVAS DVTKRLIKAN LLANNEYYFR VCAENKVGVG PTIETKTPIL
AINPIDRPGE PENLHIADKG KTFVYLKWRR PDYDGGSPNL SYHVERRLKG SDDWERVHKG
SIKETHYMVD RCVENQIYEF RVQTKNEGGE SDWVKTEEVV VKEDLQKPVL DLKLSGVLTV
KAGDTIRLEA GVRGKPFPEV AWTKDKDATD LTRSPRVKID TRADSSKFSL TKAKRSDGGK
YVVTATNTAG SFVAYATVNV LDKPGPVRNL KIVDVSSDRC TVCWDPPEDD GGCEIQNYIL
EKCETKRMVW STYSATVLTP GTTVTRLIEG NEYIFRVRAE NKIGTGPPTE SKPVIAKTKY
DKPGRPDPPE VTKVSKEEMT VVWNPPEYDG GKSITGYFLE KKEKHSTRWV PVNKSAIPER
RMKVQNLLPD HEYQFRVKAE NEIGIGEPSL PSRPVVAKDP IEPPGPPTNF RVVDTTKHSI
TLGWGKPVYD GGAPIIGYVV EMRPKIADAS PDEGWKRCNA AAQLVRKEFT VTSLDENQEY
EFRVCAQNQV GIGRPAELKE AIKPKEILEP PEIDLDASMR KLVIVRAGCP IRLFAIVRGR
PAPKVTWRKV GIDNVVRKGQ VDLVDTMAFL VIPNSTRDDS GKYSLTLVNP AGEKAVFVNV
RVLDTPGPVS DLKVSDVTKT SCHVSWAPPE NDGGSQVTHY IVEKREADRK TWSTVTPEVK
KTSFHVTNLV PGNEYYFRVT AVNEYGPGVP TDVPKPVLAS DPLSEPDPPR KLEVTEMTKN
SATLAWLPPL RDGGAKIDGY ITSYREEEQP ADRWTEYSVV KDLSLVVTGL KEGKKYKFRV
AARNAVGVSL PREAEGVYEA KEQLLPPKIL MPEQITIKAG KKLRIEAHVY GKPHPTCKWK
KGEDEVVTSS HLAVHKADSS SILIIKDVTR KDSGYYSLTA ENSSGTDTQK IKVVVMDAPG
PPQPPFDISD IDADACSLSW HIPLEDGGSN ITNYIVEKCD VSRGDWVTAL ASVTKTSCRV
GKLIPGQEYI FRVRAENRFG ISEPLTSPKM VAQFPFGVPS EPKNARVTKV NKDCIFVAWD
RPDSDGGSPI IGYLIERKER NSLLWVKAND TLVRSTEYPC AGLVEGLEYS FRIYALNKAG
SSPPSKPTEY VTARMPVDPP GKPEVIDVTK STVSLIWARP KHDGGSKIIG YFVEACKLPG
DKWVRCNTAP HQIPQEEYTA TGLEEKAQYQ FRAIARTAVN ISPPSEPSDP VTILAENVPP
RIDLSVAMKS LLTVKAGTNV CLDATVFGKP MPTVSWKKDG TLLKPAEGIK MAMQRNLCTL
ELFSVNRKDS GDYTITAENS SGSKSATIKL KVLDKPGPPA SVKINKMYSD RAMLSWEPPL
EDGGSEITNY IVDKRETSRP NWAQVSATVP ITSCSVEKLI EGHEYQFRIC AENKYGVGDP
VFTEPAIAKN PYDPPGRCDP PVISNITKDH MTVSWKPPAD DGGSPITGYL LEKRETQAVN
WTKVNRKPII ERTLKATGLQ EGTEYEFRVT AINKAGPGKP SDASKAAYAR DPQYPPGPPA
FPKVYDTTRS SVSLSWGKPA YDGGSPIIGY LVEVKRADSD NWVRCNLPQN LQKTRFEVTG
LMEDTQYQFR VYAVNKIGYS DPSDVPDKHY PKDILIPPEG ELDADLRKTL ILRAGVTMRL
YVPVKGRPPP KITWSKPNVN LRDRIGLDIK STDFDTFLRC ENVNKYDAGK YILTLENSCG
KKEYTIVVKV LDTPGPPVNV TVKEISKDSA YVTWEPPIID GGSPIINYVV QKRDAERKSW
STVTTECSKT SFRVANLEEG KSYFFRVFAE NEYGIGDPGE TRDAVKASQT PGPVVDLKVR
SVSKSSCSIG WKKPHSDGGS RIIGYVVDFL TEENKWQRVM KSLSLQYSAK DLTEGKEYTF
RVSAENENGE GTPSEITVVA RDDVVAPDLD LKGLPDLCYL AKENSNFRLK IPIKGKPAPS
VSWKKGEDPL ATDTRVSVES SAVNTTLIVY DCQKSDAGKY TITLKNVAGT KEGTISIKVV
GKPGIPTGPI KFDEVTAEAM TLKWAPPKDD GGSEITNYIL EKRDSVNNKW VTCASAVQKT
TFRVTRLHEG MEYTFRVSAE NKYGVGEGLK SEPIVARHPF DVPDAPPPPN IVDVRHDSVS
LTWTDPKKTG GSPITGYHLE FKERNSLLWK RANKTPIRMR DFKVTGLTEG LEYEFRVMAI
NLAGVGKPSL PSEPVVALDP IDPPGKPEVI NITRNSVTLI WTEPKYDGGH KLTGYIVEKR
DLPSKSWMKA NHVNVPECAF TVTDLVEGGK YEFRIRAKNT AGAISAPSES TETIICKDEY
EAPTIVLDPT IKDGLTIKAG DTIVLNAISI LGKPLPKSSW SKAGKDIRPS DITQITSTPT
SSMLTIKYAT RKDAGEYTIT ATNPFGTKVE HVKVTVLDVP GPPGPVEISN VSAEKATLTW
TPPLEDGGSP IKSYILEKRE TSRLLWTVVS EDIQSCRHVA TKLIQGNEYI FRVSAVNHYG
KGEPVQSEPV KMVDRFGPPG PPEKPEVSNV TKNTATVSWK RPVDDGGSEI TGYHVERREK
KSLRWVRAIK TPVSDLRCKV TGLQEGSTYE FRVSAENRAG IGPPSEASDS VLMKDAAYPP
GPPSNPHVTD TTKKSASLAW GKPHYDGGLE ITGYVVEHQK VGDEAWIKDT TGTALRITQF
VVPDLQTKEK YNFRISAIND AGVGEPAVIP DVEIVEREMA PDFELDAELR RTLVVRAGLS
IRIFVPIKGR PAPEVTWTKD NINLKNRANI ENTESFTLLI IPECNRYDTG KFVMTIENPA
GKKSGFVNVR VLDTPGPVLN LRPTDITKDS VTLHWDLPLI DGGSRITNYI VEKREATRKS
YSTATTKCHK CTYKVTGLSE GCEYFFRVMA ENEYGIGEPT ETTEPVKASE APSPPDSLNI
MDITKSTVSL AWPKPKHDGG SKITGYVIEA QRKGSDQWTH ITTVKGLECV VRNLTEGEEY
TFQVMAVNSA GRSAPRESRP VIVKEQTMLP ELDLRGIYQK LVIAKAGDNI KVEIPVLGRP
KPTVTWKKGD QILKQTQRVN FETTATSTIL NINECVRSDS GPYPLTARNI VGEVGDVITI
QVHDIPGPPT GPIKFDEVSS DFVTFSWDPP ENDGGVPISN YVVEMRQTDS TTWVELATTV
IRTTYKATRL TTGLEYQFRV KAQNRYGVGP GITSACIVAN YPFKVPGPPG TPQVTAVTKD
SMTISWHEPL SDGGSPILGY HVERKERNGI LWQTVSKALV PGNIFKSSGL TDGIAYEFRV
IAENMAGKSK PSKPSEPMLA LDPIDPPGKP VPLNITRHTV TLKWAKPEYT GGFKITSYIV
EKRDLPNGRW LKANFSNILE NEFTVSGLTE DAAYEFRVIA KNAAGAISPP SEPSDAITCR
DDVEAPKIKV DVKFKDTVIL KAGEAFRLEA DVSGRPPPTM EWSKDGKELE GTAKLEIKIA
DFSTNLVNKD STRRDSGAYT LTATNPGGFA KHIFNVKVLD RPGPPEGPLA VTEVTSEKCV
LSWFPPLDDG GAKIDHYIVQ KRETSRLAWT NVASEVQVTK LKVTKLLKGN EYIFRVMAVN
KYGVGEPLES EPVLAVNPYG PPDPPKNPEV TTITKDSMVV CWGHPDSDGG SEIINYIVER
RDKAGQRWIK CNKKTLTDLR YKVSGLTEGH EYEFRIMAEN AAGISAPSPT SPFYKACDTV
FKPGPPGNPR VLDTSRSSIS IAWNKPIYDG GSEITGYMVE IALPEEDEWQ IVTPPAGLKA
TSYTITGLTE NQEYKIRIYA MNSEGLGEPA LVPGTPKAED RMLPPEIELD ADLRKVVTIR
ACCTLRLFVP IKGRPAPEVK WARDHGESLD KASIESTSSY TLLIVGNVNR FDSGKYILTV
ENSSGSKSAF VNVRVLDTPG PPQDLKVKEV TKTSVTLTWD PPLLDGGSKI KNYIVEKRES
TRKAYSTVAT NCHKTSWKVD QLQEGCSYYF RVLAENEYGI GLPAETAESV KASERPLPPG
KITLMDVTRN SVSLSWEKPE HDGGSRILGY IVEMQTKGSD KWATCATVKV TEATITGLIQ
GEEYSFRVSA QNEKGISDPR QLSVPVIAKD LVIPPAFKLL FNTFTVLAGE DLKVDVPFIG
RPTPAVTWHK DNVPLKQTTR VNAESTENNS LLTIKDACRE DVGHYVVKLT NSAGEAIETL
NVIVLDKPGP PTGPVKMDEV TADSITLSWG PPKYDGGSSI NNYIVEKRDT STTTWQIVSA
TVARTTIKAC RLKTGCEYQF RIAAENRYGK STYLNSEPTV AQYPFKVPGP PGTPVVTLSS
RDSMEVQWNE PISDGGSRVI GYHLERKERN SILWVKLNKT PIPQTKFKTT GLEEGVEYEF
RVSAENIVGI GKPSKVSECY VARDPCDPPG RPEAIIVTRN SVTLQWKKPT YDGGSKITGY
IVEKKELPEG RWMKASFTNI IDTHFEVTGL VEDHRYEFRV IARNAAGVFS EPSESTGAIT
ARDEVDPPRI SMDPKYKDTI VVHAGESFKV DADIYGKPIP TIQWIKGDQE LSNTARLEIK
STDFATSLSV KDAVRVDSGN YILKAKNVAG ERSVTVNVKV LDRPGPPEGP VVISGVTAEK
CTLAWKPPLQ DGGSDIINYI VERRETSRLV WTVVDANVQT LSCKVTKLLE GNEYTFRIMA
VNKYGVGEPL ESEPVVAKNP FVVPDAPKAP EVTTVTKDSM IVVWERPASD GGSEILGYVL
EKRDKEGIRW TRCHKRLIGE LRLRVTGLIE NHDYEFRVSA ENAAGLSEPS PPSAYQKACD
PIYKPGPPNN PKVIDITRSS VFLSWSKPIY DGGCEIQGYI VEKCDVSVGE WTMCTPPTGI
NKTNIEVEKL LEKHEYNFRI CAINKAGVGE HADVPGPIIV EEKLEAPDID LDLELRKIIN
IRAGGSLRLF VPIKGRPTPE VKWGKVDGEI RDAAIIDVTS SFTSLVLDNV NRYDSGKYTL
TLENSSGTKS AFVTVRVLDT PSPPVNLKVT EITKDSVSIT WEPPLLDGGS KIKNYIVEKR
EATRKSYAAV VTNCHKNSWK IDQLQEGCSY YFRVTAENEY GIGLPAQTAD PIKVAEVPQP
PGKITVDDVT RNSVSLSWTK PEHDGGSKII QYIVEMQAKH SEKWSECARV KSLQAVITNL
TQGEEYLFRV VAVNEKGRSD PRSLAVPIVA KDLVIEPDVK PAFSSYSVQV GQDLKIEVPI
SGRPKPTITW TKDGLPLKQT TRINVTDSLD LTTLSIKETH KDDGGQYGIT VANVVGQKTA
SIEIVTLDKP DPPKGPVKFD DVSAESITLS WNPPLYTGGC QITNYIVQKR DTTTTVWDVV
SATVARTTLK VTKLKTGTEY QFRIFAENRY GQSFALESDP IVAQYPYKEP GPPGTPFATA
ISKDSMVIQW HEPVNNGGSP VIGYHLERKE RNSILWTKVN KTIIHDTQFK AQNLEEGIEY
EFRVYAENIV GVGKASKNSE CYVARDPCDP PGTPEPIMVK RNEITLQWTK PVYDGGSMIT
GYIVEKRDLP DGRWMKASFT NVIETQFTVS GLTEDQRYEF RVIAKNAAGA ISKPSDSTGP
ITAKDEVELP RISMDPKFRD TIVVNAGETF RLEADVHGKP LPTIEWLRGD KEIEESARCE
IKNTDFKALL IVKDAIRIDG GQYILRASNV AGSKSFPVNV KVLDRPGPPE GPVQVTGVTS
EKCSLTWSPP LQDGGSDISH YVVEKRETSR LAWTVVASEV VTNSLKVTKL LEGNEYVFRI
MAVNKYGVGE PLESAPVLMK NPFVLPGPPK SLEVTNIAKD SMTVCWNRPD SDGGSEIIGY
IVEKRDRSGI RWIKCNKRRI TDLRLRVTGL TEDHEYEFRV SAENAAGVGE PSPATVYYKA
CDPVFKPGPP TNAHIVDTTK NSITLAWGKP IYDGGSEILG YVVEICKADE EEWQIVTPQT
GLRVTRFEIS KLTEHQEYKI RVCALNKVGL GEATSVPGTV KPEDKLEAPE LDLDSELRKG
IVVRAGGSAR IHIPFKGRPT PEITWSREEG EFTDKVQIEK GVNYTQLSID NCDRNDAGKY
ILKLENSSGS KSAFVTVKVL DTPGPPQNLA VKEVRKDSAF LVWEPPIIDG GAKVKNYVID
KRESTRKAYA NVSSKCSKTS FKVENLTEGA IYYFRVMAEN EFGVGVPVET VDAVKAAEPP
SPPGKVTLTD VSQTSASLMW EKPEHDGGSR VLGYVVEMQP KGTEKWSIVA ESKVCNAVVT
GLSSGQEYQF RVKAYNEKGK SDPRVLGVPV IAKDLTIQPS LKLPFNTYSI QAGEDLKIEI
PVIGRPRPNI SWVKDGEPLK QTTRVNVEET ATSTVLHIKE GNKDDFGKYT VTATNSAGTA
TENLSVIVLE KPGPPVGPVR FDEVSADFVV ISWEPPAYTG GCQISNYIVE KRDTTTTTWH
MVSATVARTT IKITKLKTGT EYQFRIFAEN RYGKSAPLDS KAVIVQYPFK EPGPPGTPFV
TSISKDQMLV QWHEPVNDGG TKIIGYHLEQ KEKNSILWVK LNKTPIQDTK FKTTGLDEGL
EYEFKVSAEN IVGIGKPSKV SECFVARDPC DPPGRPEAIV ITRNNVTLKW KKPAYDGGSK
ITGYIVEKKD LPDGRWMKAS FTNVLETEFT VSGLVEDQRY EFRVIARNAA GNFSEPSDSS
GAITARDEID APNASLDPKY KDVIVVHAGE TFVLEADIRG KPIPDVVWSK DGKELEETAA
RMEIKSTIQK TTLVVKDCIR TDGGQYILKL SNVGGTKSIP ITVKVLDRPG PPEGPLKVTG
VTAEKCYLAW NPPLQDGGAN ISHYIIEKRE TSRLSWTQVS TEVQALNYKV TKLLPGNEYI
FRVMAVNKYG IGEPLESGPV TACNPYKPPG PPSTPEVSAI TKDSMVVTWA RPVDDGGTEI
EGYILEKRDK EGVRWTKCNK KTLTDLRLRV TGLTEGHSYE FRVAAENAAG VGEPSEPSVF
YRACDALYPP GPPSNPKVTD TSRSSVSLAW SKPIYDGGAP VKGYVVEVKE AAADEWTTCT
PPTGLQGKQF TVTKLKENTE YNFRICAINS EGVGEPATLP GSVVAQERIE PPEIELDADL
RKVVVLRASA TLRLFVTIKG RPEPEVKWEK AEGILTDRAQ IEVTSSFTML VIDNVTRFDS
GRYNLTLENN SGSKTAFVNV RVLDSPSAPV NLTIREVKKD SVTLSWEPPL IDGGAKITNY
IVEKRETTRK AYATITNNCT KTTFRIENLQ EGCSYYFRVL ASNEYGIGLP AETTEPVKVS
EPPLPPGRVT LVDVTRNTAT IKWEKPESDG GSKITGYVVE MQTKGSEKWS TCTQVKTLEA
TISGLTAGEE YVFRVAAVNE KGRSDPRQLG VPVIARDIEI KPSVELPFHT FNVKAREQLK
IDVPFKGRPQ ATVNWRKDGQ TLKETTRVNV SSSKTVTSLS IKEASKEDVG TYELCVSNSA
GSITVPITII VLDRPGPPGP IRIDEVSCDS ITISWNPPEY DGGCQISNYI VEKKETTSTT
WHIVSQAVAR TSIKIVRLTT GSEYQFRVCA ENRYGKSSYS ESSAVVAEYP FSPPGPPGTP
KVVHATKSTM LVTWQVPVND GGSRVIGYHL EYKERSSILW SKANKILIAD TQMKVSGLDE
GLMYEYRVYA ENIAGIGKCS KSCEPVPARD PCDPPGQPEV TNITRKSVSL KWSKPHYDGG
AKITGYIVER RELPDGRWLK CNYTNIQETY FEVTELTEDQ RYEFRVFARN AADSVSEPSE
STGPIIVKDD VEPPRVMMDV KFRDVIVVKA GEVLKINADI AGRPLPVISW AKDGIEIEER
ARTEIISTDN HTLLTVKDCI RRDTGQYVLT LKNVAGTRSV AVNCKVLDKP GPPAGPLEIN
GLTAEKCSLS WGRPQEDGGA DIDYYIVEKR ETSHLAWTIC EGELQMTSCK VTKLLKGNEY
IFRVTGVNKY GVGEPLESVA IKALDPFTVP SPPTSLEITS VTKESMTLCW SRPESDGGSE
ISGYIIERRE KNSLRWVRVN KKPVYDLRVK STGLREGCEY EYRVYAENAA GLSLPSETSP
LIRAEDPVFL PSPPSKPKIV DSGKTTITIA WVKPLFDGGA PITGYTVEYK KSDDTDWKTS
IQSLRGTEYT ISGLTTGAEY VFRVKSVNKV GASDPSDSSD PQIAKEREEE PLFDIDSEMR
KTLIVKAGAS FTMTVPFRGR PVPNVLWSKP DTDLRTRAYV DTTDSRTSLT IENANRNDSG
KYTLTIQNVL SAASLTLVVK VLDTPGPPTN ITVQDVTKES AVLSWDVPEN DGGAPVKNYH
IEKREASKKA WVSVTNNCNR LSYKVTNLQE GAIYYFRVSG ENEFGVGIPA ETKEGVKITE
KPSPPEKLGV TSISKDSVSL TWLKPEHDGG SRIVHYVVEA LEKGQKNWVK CAVAKSTHHV
VSGLRENSEY FFRVFAENQA GLSDPRELLL PVLIKEQLEP PEIDMKNFPS HTVYVRAGSN
LKVDIPISGK PLPKVTLSRD GVPLKATMRF NTEITAENLT INLKESVTAD AGRYEITAAN
SSGTTKAFIN IVVLDRPGPP TGPVVISDIT EESVTLKWEP PKYDGGSQVT NYILLKRETS
TAVWTEVSAT VARTMMKVMK LTTGEEYQFR IKAENRFGIS DHIDSACVTV KLPYTTPGPP
STPWVTNVTR ESITVGWHEP VSNGGSAVVG YHLEMKDRNS ILWQKANKLV IRTTHFKVTT
ISAGLIYEFR VYAENAAGVG KPSHPSEPVL AIDACEPPRN VRITDISKNS VSLSWQQPAF
DGGSKITGYI VERRDLPDGR WTKASFTNVT ETQFIISGLT QNSQYEFRVF ARNAVGSISN
PSEVVGPITC IDSYGGPVID LPLEYTEVVK YRAGTSVKLR AGISGKPAPT IEWYKDDKEL
QTNALVCVEN TTDLASILIK DADRLNSGCY ELKLRNAMGS ASATIRVQIL DKPGPPGGPI
EFKTVTAEKI TLLWRPPADD GGAKITHYIV EKRETSRVVW SMVSEHLEEC IITTTKIIKG
NEYIFRVRAV NKYGIGEPLE SDSVVAKNAF VTPGPPGIPE VTKITKNSMT VVWSRPIADG
GSDISGYFLE KRDKKSLGWF KVLKETIRDT RQKVTGLTEN SDYQYRVCAV NAAGQGPFSE
PSEFYKAADP IDPPGPPAKI RIADSTKSSI TLGWSKPVYD GGSAVTGYVV EIRQGEEEEW
TTVSTKGEVR TTEYVVSNLK PGVNYYFRVS AVNCAGQGEP IEMNEPVQAK DILEAPEIDL
DVALRTSVIA KAGEDVQVLI PFKGRPPPTV TWRKDEKNLG SDARYSIENT DSSSLLTIPQ
VTRNDTGKYI LTIENGVGEP KSSTVSVKVL DTPAACQKLQ VKHVSRGTVT LLWDPPLIDG
GSPIINYVIE KRDATKRTWS VVSHKCSSTS FKLIDLSEKT PFFFRVLAEN EIGIGEPCET
TEPVKAAEVP APIRDLSMKD STKTSVILSW TKPDFDGGSV ITEYVVERKG KGEQTWSHAG
ISKTCEIEVS QLKEQSVLEF RVFAKNEKGL SDPVTIGPIT VKELIITPEV DLSDIPGAQV
TVRIGHNVHL ELPYKGKPKP SISWLKDGLP LKESEFVRFS KTENKITLSI KNAKKEHGGK
YTVILDNAVC RIAVPITVIT LGPPSKPKGP IRFDEIKADS VILSWDVPED NGGGEITCYS
IEKRETSQTN WKMVCSSVAR TTFKVPNLVK DAEYQFRVRA ENRYGVSQPL VSSIIVAKHQ
FRIPGPPGKP VIYNVTSDGM SLTWDAPVYD GGSEVTGFHV EKKERNSILW QKVNTSPISG
REYRATGLVE GLDYQFRVYA ENSAGLSSPS DPSKFTLAVS PVDPPGTPDY IDVTRETITL
KWNPPLRDGG SKIVGYSIEK RQGNERWVRC NFTDVSECQY TVTGLSPGDR YEFRIIARNA
VGTISPPSQS SGIIMTRDEN VPPIVEFGPE YFDGLIIKSG ESLRIKALVQ GRPVPRVTWF
KDGVEIEKRM NMEITDVLGS TSLFVRDATR DHRGVYTVEA KNASGSAKAE IKVKVQDTPG
KVVGPIRFTN ITGEKMTLWW DAPLNDGCAP ITHYIIEKRE TSRLAWALIE DKCEAQSYTA
IKLINGNEYQ FRVSAVNKFG VGRPLDSDPV VAQIQYTVPD APGIPEPSNI TGNSITLTWA
RPESDGGSEI QQYILERREK KSTRWVKVIS KRPISETRFK VTGLTEGNEY EFHVMAENAA
GVGPASGISR LIKCREPVNP PGPPTVVKVT DTSKTTVSLE WSKPVFDGGM EIIGYIIEMC
KADLGDWHKV NAEACVKTRY TVTDLQAGEE YKFRVSAING AGKGDSCEVT GTIKAVDRLT
APELDIDANF KQTHVVRAGA SIRLFIAYQG RPTPTAVWSK PDSNLSLRAD IHTTDSFSTL
TVENCNRNDA GKYTLTVENN SGSKSITFTV KVLDTPGPPG PITFKDVTRG SATLMWDAPL
LDGGARIHHY VVEKREASRR SWQVISEKCT RQIFKVNDLA EGVPYYFRVS AVNEYGVGEP
YEMPEPIVAT EQPAPPRRLD VVDTSKSSAV LAWLKPDHDG GSRITGYLLE MRQKGSDFWV
EAGHTKQLTF TVERLVEKTE YEFRVKAKND AGYSEPREAF SSVIIKEPQI EPTADLTGIT
NQLITCKAGS PFTIDVPISG RPAPKVTWKL EEMRLKETDR VSITTTKDRT TLTVKDSMRG
DSGRYFLTLE NTAGVKTFSV TVVVIGRPGP VTGPIEVSSV SAESCVLSWG EPKDGGGTEI
TNYIVEKRES GTTAWQLVNS SVKRTQIKVT HLTKYMEYSF RVSSENRFGV SKPLESAPII
AEHPFVPPSA PTRPEVYHVS ANAMSIRWEE PYHDGGSKII GYWVEKKERN TILWVKENKV
PCLECNYKVT GLVEGLEYQF RTYALNAAGV SKASEASRPI MAQNPVDAPG RPEVTDVTRS
TVSLIWSAPA YDGGSKVVGY IIERKPVSEV GDGRWLKCNY TIVSDNFFTV TALSEGDTYE
FRVLAKNAAG VISKGSESTG PVTCRDEYAP PKAELDARLH GDLVTIRAGS DLVLDAAVGG
KPEPKIIWTK GDKELDLCEK VSLQYTGKRA TAVIKFCDRS DSGKYTLTVK NASGTKAVSV
MVKVLDSPGP CGKLTVSRVT QEKCTLAWSL PQEDGGAEIT HYIVERRETS RLNWVIVEGE
CPTLSYVVTR LIKNNEYIFR VRAVNKYGPG VPVESEPIVA RNSFTIPSPP GIPEEVGTGK
EHIIIQWTKP ESDGGNEISN YLVDKREKKS LRWTRVNKDY VVYDTRLKVT SLMEGCDYQF
RVTAVNAAGN SEPSEASNFI SCREPSYTPG PPSAPRVVDT TKHSISLAWT KPMYDGGTDI
VGYVLEMQEK DTDQWYRVHT NATIRNTEFT VPDLKMGQKY SFRVAAVNVK GMSEYSESIA
EIEPVERIEI PDLELADDLK KTVTIRAGAS LRLMVSVSGR PPPVITWSKQ GIDLASRAII
DTTESYSLLI VDKVNRYDAG KYTIEAENQS GKKSATVLVK VYDTPGPCPS VKVKEVSRDS
VTITWEIPTI DGGAPVNNYI VEKREAAMRA FKTVTTKCSK TLYRISGLVE GTMYYFRVLP
ENIYGIGEPC ETSDAVLVSE VPLVPAKLEV VDVTKSTVTL AWEKPLYDGG SRLTGYVLEA
CKAGTERWMK VVTLKPTVLE HTVTSLNEGE QYLFRIRAQN EKGVSEPRET VTAVTVQDLR
VLPTIDLSTM PQKTIHVPAG RPVELVIPIA GRPPPAASWF FAGSKLRESE RVTVETHTKV
AKLTIRETTI RDTGEYTLEL KNVTGTTSET IKVIILDKPG PPTGPIKIDE IDATSITISW
EPPELDGGAP LSGYVVEQRD AHRPGWLPVS ESVTRSTFKF TRLTEGNEYV FRVAATNRFG
IGSYLQSEVI ECRSSIRIPG PPETLQIFDV SRDGMTLTWY PPEDDGGSQV TGYIVERKEV
RADRWVRVNK VPVTMTRYRS TGLTEGLEYE HRVTAINARG SGKPSRPSKP IVAMDPIAPP
GKPQNPRVTD TTRTSVSLAW SVPEDEGGSK VTGYLIEMQK VDQHEWTKCN TTPTKIREYT
LTHLPQGAEY RFRVLACNAG GPGEPAEVPG TVKVTEMLEY PDYELDERYQ EGIFVRQGGV
IRLTIPIKGK PFPICKWTKE GQDISKRAMI ATSETHTELV IKEADRGDSG TYDLVLENKC
GKKAVYIKVR VIGSPNSPEG PLEYDDIQVR SVRVSWRPPA DDGGADILGY ILERREVPKA
AWYTIDSRVR GTSLVVKGLK ENVEYHFRVS AENQFGISKP LKSEEPVTPK TPLNPPEPPS
NPPEVLDVTK SSVSLSWSRP KDDGGSRVTG YYIERKETST DKWVRHNKTQ ITTTMYTVTG
LVPDAEYQFR IIAQNDVGLS ETSPASEPVV CKDPFDKPSQ PGELEILSIS KDSVTLQWEK
PECDGGKEIL GYWVEYRQSG DSAWKKSNKE RIKDKQFTIG GLLEATEYEF RVFAENETGL
SRPRRTAMSI KTKLTSGEAP GIRKEMKDVT TKLGEAAQLS CQIVGRPLPD IKWYRFGKEL
IQSRKYKMSS DGRTHTLTVM TEEQEDEGVY TCIATNEVGE VETSSKLLLQ ATPQFHPGYP
LKEKYYGAVG STLRLHVMYI GRPVPAMTWF HGQKLLQNSE NITIENTEHY THLVMKNVQR
KTHAGKYKVQ LSNVFGTVDA ILDVEIQDKP DKPTGPIVIE ALLKNSAVIS WKPPADDGGS
WITNYVVEKC EAKEGAEWQL VSSAISVTTC RIVNLTENAG YYFRVSAQNT FGISDPLEVS
SVVIIKSPFE KPGAPGKPTI TAVTKDSCVV AWKPPASDGG AKIRNYYLEK REKKQNKWIS
VTTEEIRETV FSVKNLIEGL EYEFRVKCEN LGGESEWSEI SEPITPKSDV PIQAPHFKEE
LRNLNVRYQS NATLVCKVTG HPKPIVKWYR QGKEIIADGL KYRIQEFKGG YHQLIIASVT
DDDATVYQVR ATNQGGSVSG TASLEVEVPA KIHLPKTLEG MGAVHALRGE VVSIKIPFSG
KPDPVITWQK GQDLIDNNGH YQVIVTRSFT SLVFPNGVER KDAGFYVVCA KNRFGIDQKT
VELDVADVPD PPRGVKVSDV SRDSVNLTWT EPASDGGSKI TNYIVEKCAT TAERWLRVGQ
ARETRYTVIN LFGKTSYQFR VIAENKFGLS KPSEPSEPTI TKEDKTRAMN YDEEVDETRE
VSMTKASHSS TKELYEKYMI AEDLGRGEFG IVHRCVETSS KKTYMAKFVK VKGTDQVLVK
KEISILNIAR HRNILHLHES FESMEELVMI FEFISGLDIF ERINTSAFEL NEREIVSYVH
QVCEALQFLH SHNIGHFDIR PENIIYQTRR SSTIKIIEFG QARQLKPGDN FRLLFTAPEY
YAPEVHQHDV VSTATDMWSL GTLVYVLLSG INPFLAETNQ QIIENIMNAE YTFDEEAFKE
ISIEAMDFVD RLLVKERKSR MTASEALQHP WLKQKIERVS TKVIRTLKHR RYYHTLIKKD
LNMVVSAARI SCGGAIRSQK GVSVAKVKVA SIEIGPVSGQ IMHAVGEEGG HVKYVCKIEN
YDQSTQVTWY FGVRQLENSE KYEITYEDGV AILYVKDITK LDDGTYRCKV VNDYGEDSSY
AELFVKGVRE VYDYYCRRTM KKIKRRTDTM RLLERPPEFT LPLYNKTAYV GENVRFGVTI
TVHPEPHVTW YKSGQKIKPG DNDKKYTFES DKGLYQLTIN SVTTDDDAEY TVVARNKYGE
DSCKAKLTVT LHPPPTDSTL RPMFKRLLAN AECQEGQSVC FEIRVSGIPP PTLKWEKDGQ
PLSLGPNIEI IHEGLDYYAL HIRDTLPEDT GYYRVTATNT AGSTSCQAHL QVERLRYKKQ
EFKSKEEHER HVQKQIDKTL RMAEILSGTE SVPLTQVAKE ALREAAVLYK PAVSTKTVKG
EFRLEIEEKK EERKLRMPYD VPEPRKYKQT TIEEDQRIKQ FVPMSDMKWY KKIRDQYEMP
GKLDRVVQKR PKRIRLSRWE QFYVMPLPRI TDQYRPKWRI PKLSQDDLEI VRPARRRTPS
PDYDFYYRPR RRSLGDISDE ELLLPIDDYL AMKRTEEERL RLEEELELGF SASPPSRSPP
HFELSSLRYS SPQAHVKVEE TRKDFRYSTY HIPTKAEAST SYAELRERHA QAAYRQPKQR
QRIMAEREDE ELLRPVTTTQ HLSEYKSELD FMSKEEKSRK KSRRQREVTE ITEIEEEYEI
SKHAQRESSS SASRLLRRRR SLSPTYIELM RPVSELIRSR PQPAEEYEDD TERRSPTPER
TRPRSPSPVS SERSLSRFER SARFDIFSRY ESMKAALKTQ KTSERKYEVL SQQPFTLDHA
PRITLRMRSH RVPCGQNTRF ILNVQSKPTA EVKWYHNGVE LQESSKIHYT NTSGVLTLEI
LDCHTDDSGT YRAVCTNYKG EASDYATLDV TGGDYTTYAS QRRDEEVPRS VFPELTRTEA
YAVSSFKKTS EMEASSSVRE VKSQMTETRE SLSSYEHSAS AEMKSAALEE KSLEEKSTTR
KIKTTLAARI LTKPRSMTVY EGESARFSCD TDGEPVPTVT WLRKGQVLST SARHQVTTTK
YKSTFEISSV QASDEGNYSV VVENSEGKQE AEFTLTIQKA RVTEKAVTSP PRVKSPEPRV
KSPEAVKSPK RVKSPEPSHP KAVSPTETKP TPTEKVQHLP VSAPPKITQF LKAEASKEIA
KLTCVVESSV LRAKEVTWYK DGKKLKENGH FQFHYSADGT YELKINNLTE SDQGEYVCEI
SGEGGTSKTN LQFMGQAFKS IHEKVSKISE TKKSDQKTTE STVTRKTEPK APEPISSKPV
IVTGLQDTTV SSDSVAKFAV KATGEPRPTA IWTKDGKAIT QGGKYKLSED KGGFFLEIHK
TDTSDSGLYT CTVKNSAGSV SSSCKLTIKA IKDTEAQKVS TQKTSEITPQ KKAVVQEEIS
QKALRSEEIK MSEAKSQEKL ALKEEASKVL ISEEVKKSAA TSLEKSIVHE EITKTSQASE
EVRTHAEIKA FSTQMSINEG QRLVLKANIA GATDVKWVLN GVELTNSEEY RYGVSGSDQT
LTIKQASHRD EGILTCISKT KEGIVKCQYD LTLSKELSDA PAFISQPRSQ NINEGQNVLF
TCEISGEPSP EIEWFKNNLP ISISSNVSIS RSRNVYSLEI RNASVSDSGK YTIKAKNFRG
QCSATASLMV LPLVEEPSRE VVLRTSGDTS LQGSFSSQSV QMSASKQEAS FSSFSSSSAS
SMTEMKFASM SAQSMSSMQE SFVEMSSSSF MGISNMTQLE SSTSKMLKAG IRGIPPKIEA
LPSDISIDEG KVLTVACAFT GEPTPEVTWS CGGRKIHSQE QGRFHIENTD DLTTLIIMDV
QKQDGGLYTL SLGNEFGSDS ATVNIHIRSI


Related products :

Catalog number Product name Quantity
U1667h CLIA Connectin,Homo sapiens,Human,Rhabdomyosarcoma antigen MU-RMS-40.14,Titin,TTN 96T
E1667h ELISA kit Connectin,Homo sapiens,Human,Rhabdomyosarcoma antigen MU-RMS-40.14,Titin,TTN 96T
E1667h ELISA Connectin,Homo sapiens,Human,Rhabdomyosarcoma antigen MU-RMS-40.14,Titin,TTN 96T
E1667m ELISA kit Connectin,Mouse,Mus musculus,Titin,Ttn 96T
U1667m CLIA Connectin,Mouse,Mus musculus,Titin,Ttn 96T
E1667m ELISA Connectin,Mouse,Mus musculus,Titin,Ttn 96T
EIAAB26112 190 kDa connectin-associated protein,190 kDa titin-associated protein,Homo sapiens,Human,MYOM1,Myomesin family member 1,Myomesin-1
EIAAB26113 165 kDa connectin-associated protein,165 kDa titin-associated protein,Homo sapiens,Human,M-protein,MYOM2,Myomesin family member 2,Myomesin-2
15-288-21284 Hypothetical rhabdomyosarcoma antigen MU-RMS-40.6A - Polyclonal 0.05 mg
15-288-21284 Hypothetical rhabdomyosarcoma antigen MU-RMS-40.6A - Polyclonal 0.1 mg
'H00007273-P01-10 Titin antigen 10
'H00007273-Q02-25 Titin antigen 25
'H00007273-P01-25 Titin antigen 25
'H00007273-Q02-10 Titin antigen 10
'H00007273-Q02 Titin antigen 10
'H00007273-Q01-25 Titin antigen 25
'H00007273-Q01-10 Titin antigen 10
EIAAB26119 Mouse,Mus musculus,Myofibrillar titin-like Ig domains protein,Myot,Myotilin,Titin immunoglobulin domain protein,Ttid
EIAAB26120 57 kDa cytoskeletal protein,Homo sapiens,Human,Myofibrillar titin-like Ig domains protein,MYOT,Myotilin,Titin immunoglobulin domain protein,TTID
30-383 Sarcomere assembly is regulated by the muscle protein titin. Titin is a giant elastic protein with kinase activity that extends half the length of a sarcomere. It serves as a scaffold to which myofibr 0.1 mg
EIAAB39486 Arsenite-related gene 1 protein,CCDC99,Coiled-coil domain-containing protein 99,Homo sapiens,hSpindly,Human,Protein Spindly,Rhabdomyosarcoma antigen MU-RMS-40.4A
MCA5176Z MOUSE ANTI HUMAN TITIN Azide free, Product Type Monoclonal Antibody, Specificity TITIN, Target Species Human, Host Mouse, Format Azide Free, Isotypes IgG1, Applications P, Clone 2B3 0.1 mg
EIAAB29461 C14orf10,G5PR,Homo sapiens,Human,PPP2R3C,Protein phosphatase subunit G5PR,Rhabdomyosarcoma antigen MU-RMS-40.6A_6C,Serine_threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
MAB566P Rhabdomyosarcoma Antibody 5 ml
MAB566C Rhabdomyosarcoma Antibody 0.5 ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur