Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Transcription factor COE2 (Early B-cell factor 2) (EBF-2)

 COE2_HUMAN              Reviewed;         575 AA.
Q9HAK2; A0PJM4; A6NMF7; F5H645; Q66VZ3; Q6DK36; Q6IS86; Q6ISA4;
28-NOV-2002, integrated into UniProtKB/Swiss-Prot.
12-DEC-2006, sequence version 4.
23-MAY-2018, entry version 136.
RecName: Full=Transcription factor COE2;
AltName: Full=Early B-cell factor 2;
Short=EBF-2;
Name=EBF2; Synonyms=COE2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Li H., Shen C., Zhou G., Ke R., Zhong G., Lin L., Yang S.;
Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16421571; DOI=10.1038/nature04406;
Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S.,
Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A.,
Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X.,
Allen N.R., Anderson S., Asakawa T., Blechschmidt K., Bloom T.,
Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K.,
DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G.,
Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B.,
Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P.,
Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H.,
Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C.,
O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K.,
Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R.,
Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K.,
Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q.,
Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N.,
Lander E.S.;
"DNA sequence and analysis of human chromosome 8.";
Nature 439:331-335(2006).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 233-575 (ISOFORM 1).
TISSUE=Embryo;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 240-575 (ISOFORM 1).
TISSUE=Brain, and Fetal brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Transcription factor that, in osteoblasts, activates the
decoy receptor for RANKL, TNFRSF11B, which in turn regulates
osteoclast differentiation. Acts in synergy with the Wnt-
responsive LEF1/CTNNB1 pathway. Recognizes variations of the
palindromic sequence 5'-ATTCCCNNGGGAATT-3' (By similarity).
{ECO:0000250}.
-!- SUBUNIT: Forms either a homodimer or a heterodimer with a related
family member. {ECO:0000250}.
-!- INTERACTION:
Q13077:TRAF1; NbExp=4; IntAct=EBI-12267154, EBI-359224;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9HAK2-1; Sequence=Displayed;
Name=2;
IsoId=Q9HAK2-2; Sequence=VSP_055530, VSP_055531;
-!- SIMILARITY: Belongs to the COE family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAB13843.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AY700779; AAU10086.1; -; mRNA.
EMBL; AC023566; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC090103; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AK021562; BAB13843.1; ALT_INIT; mRNA.
EMBL; BC069665; AAH69665.1; -; mRNA.
EMBL; BC069726; AAH69726.1; -; mRNA.
EMBL; BC069747; AAH69747.1; -; mRNA.
EMBL; BC069768; AAH69768.1; -; mRNA.
EMBL; BC074794; AAH74794.2; -; mRNA.
EMBL; BC113478; AAI13479.1; -; mRNA.
EMBL; BC113504; AAI13505.1; -; mRNA.
CCDS; CCDS43726.1; -. [Q9HAK2-1]
RefSeq; NP_073150.2; NM_022659.3. [Q9HAK2-1]
UniGene; Hs.491292; -.
ProteinModelPortal; Q9HAK2; -.
SMR; Q9HAK2; -.
BioGrid; 122221; 1.
IntAct; Q9HAK2; 2.
STRING; 9606.ENSP00000430241; -.
iPTMnet; Q9HAK2; -.
PhosphoSitePlus; Q9HAK2; -.
SwissPalm; Q9HAK2; -.
BioMuta; EBF2; -.
DMDM; 119370337; -.
EPD; Q9HAK2; -.
MaxQB; Q9HAK2; -.
PaxDb; Q9HAK2; -.
PeptideAtlas; Q9HAK2; -.
PRIDE; Q9HAK2; -.
DNASU; 64641; -.
Ensembl; ENST00000520164; ENSP00000430241; ENSG00000221818. [Q9HAK2-1]
Ensembl; ENST00000535548; ENSP00000437909; ENSG00000221818. [Q9HAK2-2]
GeneID; 64641; -.
KEGG; hsa:64641; -.
UCSC; uc003xes.3; human. [Q9HAK2-1]
CTD; 64641; -.
DisGeNET; 64641; -.
EuPathDB; HostDB:ENSG00000221818.8; -.
GeneCards; EBF2; -.
HGNC; HGNC:19090; EBF2.
MIM; 609934; gene.
neXtProt; NX_Q9HAK2; -.
OpenTargets; ENSG00000221818; -.
PharmGKB; PA38794; -.
eggNOG; KOG3836; Eukaryota.
eggNOG; ENOG410XQ9Z; LUCA.
GeneTree; ENSGT00390000014051; -.
HOGENOM; HOG000092311; -.
HOVERGEN; HBG005108; -.
InParanoid; Q9HAK2; -.
KO; K09103; -.
OMA; EYATPCI; -.
OrthoDB; EOG091G0A9D; -.
PhylomeDB; Q9HAK2; -.
TreeFam; TF313391; -.
ChiTaRS; EBF2; human.
GenomeRNAi; 64641; -.
PRO; PR:Q9HAK2; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000221818; -.
CleanEx; HS_EBF2; -.
ExpressionAtlas; Q9HAK2; baseline and differential.
Genevisible; Q9HAK2; HS.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
GO; GO:0003682; F:chromatin binding; IEA:Ensembl.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0046983; F:protein dimerization activity; IEA:InterPro.
GO; GO:0000978; F:RNA polymerase II proximal promoter sequence-specific DNA binding; IEA:Ensembl.
GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB.
GO; GO:0001077; F:transcriptional activator activity, RNA polymerase II proximal promoter sequence-specific DNA binding; IEA:Ensembl.
GO; GO:0060612; P:adipose tissue development; IEA:Ensembl.
GO; GO:0050873; P:brown fat cell differentiation; IEA:Ensembl.
GO; GO:0001709; P:cell fate determination; IEA:Ensembl.
GO; GO:0035563; P:positive regulation of chromatin binding; IEA:Ensembl.
CDD; cd01175; IPT_COE; 1.
Gene3D; 2.60.40.10; -; 1.
Gene3D; 2.60.40.3180; -; 1.
Gene3D; 4.10.280.10; -; 2.
InterPro; IPR032200; COE_DBD.
InterPro; IPR038173; COE_DBD_sf.
InterPro; IPR032201; COE_HLH.
InterPro; IPR038006; COE_IPT.
InterPro; IPR036638; HLH_DNA-bd_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR014756; Ig_E-set.
InterPro; IPR002909; IPT_dom.
InterPro; IPR003523; Transcription_factor_COE.
InterPro; IPR018350; Transcription_factor_COE_CS.
PANTHER; PTHR10747; PTHR10747; 1.
Pfam; PF16422; COE1_DBD; 1.
Pfam; PF16423; COE1_HLH; 1.
Pfam; PF01833; TIG; 1.
SMART; SM00429; IPT; 1.
SUPFAM; SSF81296; SSF81296; 1.
PROSITE; PS01345; COE; 1.
1: Evidence at protein level;
Activator; Alternative splicing; Complete proteome;
Developmental protein; DNA-binding; Metal-binding; Nucleus;
Polymorphism; Reference proteome; Transcription;
Transcription regulation; Zinc; Zinc-finger.
CHAIN 1 575 Transcription factor COE2.
/FTId=PRO_0000107828.
DOMAIN 253 336 IPT/TIG.
ZN_FING 150 169 C5-type. {ECO:0000255}.
REGION 62 65 Interaction with DNA. {ECO:0000250}.
REGION 196 203 Interaction with DNA. {ECO:0000250}.
REGION 235 238 Interaction with DNA. {ECO:0000250}.
COMPBIAS 453 534 Pro/Ser/Thr-rich.
SITE 162 162 Interaction with DNA. {ECO:0000250}.
SITE 171 171 Interaction with DNA. {ECO:0000250}.
VAR_SEQ 1 269 Missing (in isoform 2).
{ECO:0000303|Ref.1}.
/FTId=VSP_055530.
VAR_SEQ 510 575 IMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQG
SPSPACSSGNGNGFRAMTGLVVPPM -> TGLWLTWLLKAF
WGKKRIETIPFL (in isoform 2).
{ECO:0000303|Ref.1}.
/FTId=VSP_055531.
VARIANT 559 559 G -> S (in dbSNP:rs17054477).
/FTId=VAR_048754.
CONFLICT 483 483 S -> G (in Ref. 1; AAU10086).
{ECO:0000305}.
CONFLICT 513 513 S -> L (in Ref. 3; BAB13843).
{ECO:0000305}.
SEQUENCE 575 AA; 62650 MW; 05FCDBC9CB81EC89 CRC64;
MFGIQDTLGR GPTLKEKSLG AEMDSVRSWV RNVGVVDANV AAQSGVALSR AHFEKQPPSN
LRKSNFFHFV LALYDRQGQP VEIERTAFVD FVENDKEQGN EKTNNGTHYK LQLLYSNGVR
TEQDLYVRLI DSVTKQPIAY EGQNKNPEMC RVLLTHEVMC SRCCEKKSCG NRNETPSDPV
IIDRFFLKFF LKCNQNCLKT AGNPRDMRRF QVVLSTTVNV DGHVLAVSDN MFVHNNSKHG
RRARRLDPSE ATPCIKAISP SEGWTTGGAM VIIIGDNFFD GLQVVFGTML VWSELITPHA
IRVQTPPRHI PGVVEVTLSY KSKQFCKGAP GRFIYTALNE PTIDYGFQRL QKVIPRHPGD
PERLAKEMLL KRAADLVEAL YGTPHNNQDI ILKRAADIAE ALYSVPRNPS QLPALSSSPA
HSGMMGINSY GSQLGVSISE STQGNNQGYI RNTSSISPRG YSSSSTPQQS NYSTSSNSMN
GYSNVPMANL GVPGSPGFLN GSPTGSPYGI MSSSPTVGSS STSSILPFSS SVFPAVKQKS
AFAPVIRPQG SPSPACSSGN GNGFRAMTGL VVPPM


Related products :

Catalog number Product name Quantity
EIAAB08483 COE2,Early B-cell factor 2,EBF2,EBF-2,Homo sapiens,Human,Transcription factor COE2
EIAAB08482 Bos taurus,Bovine,COE2,Early B-cell factor 2,EBF2,EBF-2,Transcription factor COE2
EIAAB08484 Coe2,Early B-cell factor 2,Ebf2,EBF-2,Metencephalon-mesencephalon-olfactory transcription factor 1,MET-mesencephalon-olfactory TF1,MET-mesencephalon-olfactory transcription factor 1,Mmot1,Mouse,Mus mu
EIAAB08479 Coe1,Early B-cell factor,Ebf,Ebf1,O_E-1,OE-1,Olf1,Olf-1,Olfactory neuronal transcription factor,Rat,Rattus norvegicus,Transcription factor COE1
18-003-44015 Transcription factor COE4 - Early B-cell factor 4; EBF-4; Olf-1_EBF-like 4; OE-4; O_E-4 Polyclonal 0.1 mg Protein A
EIAAB42078 HMG box transcription factor 4,Homo sapiens,hTCF-4,Human,T-cell factor 4,T-cell-specific transcription factor 4,TCF4,TCF-4,TCF7L2,Transcription factor 7-like 2
EIAAB42079 HMG box transcription factor 4,Mouse,mTCF-4,Mus musculus,T-cell factor 4,T-cell-specific transcription factor 4,Tcf4,TCF-4,Tcf7l2,Transcription factor 7-like 2
EIAAB08486 COE3,Early B-cell factor 3,EBF3,EBF-3,Homo sapiens,Human,O_E-2,OE-2,Olf-1_EBF-like 2,Transcription factor COE3
EIAAB08487 COE4,Early B-cell factor 4,EBF4,EBF-4,Homo sapiens,Human,KIAA1442,O_E-4,OE-4,Olf-1_EBF-like 4,Transcription factor COE4
EIAAB08488 Coe4,Early B-cell factor 4,Ebf4,EBF-4,Mouse,Mus musculus,O_E-4,OE-4,Olf-1_EBF-like 4,Transcription factor COE4
EIAAB08485 Coe3,Early B-cell factor 3,Ebf3,EBF-3,Mouse,Mus musculus,O_E-2,OE-2,Olf-1_EBF-like 2,Transcription factor COE3
EIAAB08481 COE1,Early B-cell factor,EBF,EBF1,Homo sapiens,Human,O_E-1,OE-1,Transcription factor COE1
EIAAB08480 Coe1,Early B-cell factor,Ebf,Ebf1,Mouse,Mus musculus,O_E-1,OE-1,Transcription factor COE1
E2022b Human ELISA Kit FOR Transcription factor COE2 96T
EIAAB41708 Homo sapiens,Human,T-cell factor 1,T-cell-specific transcription factor 1,TCF1,TCF-1,TCF7,TCF-7,Transcription factor 7
H7204 Transcription factor COE2 (EBF2), Mouse, ELISA Kit 96T
CSB-EL007357BO Bovine Transcription factor COE2(EBF2) ELISA kit 96T
CSB-EL007357HU Human Transcription factor COE2(EBF2) ELISA kit 96T
H7202 Transcription factor COE2 (EBF2), Bovine, ELISA Kit 96T
H7203 Transcription factor COE2 (EBF2), Human, ELISA Kit 96T
CSB-EL007357MO Mouse Transcription factor COE2(EBF2) ELISA kit 96T
18-003-43070 T-box transcription factor TBX21 - T-box protein 21; Transcription factor TBLYM; T-cell-specific T-box transcription factor T-bet Polyclonal 0.1 mg Protein A
EIAAB47163 CREB_ATF bZIP transcription factor,Crebzf,HCF-binding transcription factor Zhangfei,Host cell factor-binding transcription factor Zhangfei,Mouse,Mus musculus,Tyrosine kinase-associated leucine zipper
EIAAB41709 Mouse,Mus musculus,T-cell factor 1,T-cell-specific transcription factor 1,Tcf1,TCF-1,Tcf-1,Tcf7,TCF-7,Transcription factor 7
E0416h ELISA kit AT225,Early growth response protein 1,EGR1,EGR-1,Homo sapiens,Human,KROX24,Nerve growth factor-induced protein A,NGFI-A,Transcription factor ETR103,Transcription factor Zif268,Zinc finger p 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur