Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Transcription factor MYB3R-2 (Myb-related protein MYB3R-2) (OsMYB3R-2)

 MB3R2_ORYSJ             Reviewed;         587 AA.
Q0JHU7; D6BV30; Q5N9U1; Q5QT31;
10-MAY-2017, integrated into UniProtKB/Swiss-Prot.
03-OCT-2006, sequence version 1.
28-MAR-2018, entry version 95.
RecName: Full=Transcription factor MYB3R-2 {ECO:0000305};
AltName: Full=Myb-related protein MYB3R-2 {ECO:0000305};
Short=OsMYB3R-2 {ECO:0000303|PubMed:17293435};
Name=MYB3R-2 {ECO:0000303|PubMed:17293435};
Synonyms=MYB15 {ECO:0000312|EMBL:CAD22534.1};
OrderedLocusNames=Os01g0841500 {ECO:0000312|EMBL:BAF06681.1},
LOC_Os01g62410 {ECO:0000305};
ORFNames=OsJ_04034 {ECO:0000312|EMBL:EEE55651.1},
P0408C03.41 {ECO:0000312|EMBL:BAD81765.1};
Oryza sativa subsp. japonica (Rice).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BOP clade;
Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
NCBI_TaxID=39947;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
Xu S., Huang W., Xu Z., Luo D., Xue H.;
"Isolation of Osmyb15, a rice MYB protein with novel structure,
playing possible significant roles during evolution from plant MYB3R
to R2R3 MYB.";
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
STRAIN=cv. Ilpoombyeo; TISSUE=Seed;
Yoon U.H., Lee G.S., Lee J.S., Hahn J.H., Kim C.K., Yun D.W.,
Kim Y.H.;
"Oryza sativa japonica group clone KCS635B12 Myb-like protein mRNA,
complete cds.";
Submitted (APR-2009) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Nipponbare;
PubMed=12447438; DOI=10.1038/nature01184;
Sasaki T., Matsumoto T., Yamamoto K., Sakata K., Baba T., Katayose Y.,
Wu J., Niimura Y., Cheng Z., Nagamura Y., Antonio B.A., Kanamori H.,
Hosokawa S., Masukawa M., Arikawa K., Chiden Y., Hayashi M.,
Okamoto M., Ando T., Aoki H., Arita K., Hamada M., Harada C.,
Hijishita S., Honda M., Ichikawa Y., Idonuma A., Iijima M., Ikeda M.,
Ikeno M., Ito S., Ito T., Ito Y., Ito Y., Iwabuchi A., Kamiya K.,
Karasawa W., Katagiri S., Kikuta A., Kobayashi N., Kono I.,
Machita K., Maehara T., Mizuno H., Mizubayashi T., Mukai Y.,
Nagasaki H., Nakashima M., Nakama Y., Nakamichi Y., Nakamura M.,
Namiki N., Negishi M., Ohta I., Ono N., Saji S., Sakai K., Shibata M.,
Shimokawa T., Shomura A., Song J., Takazaki Y., Terasawa K., Tsuji K.,
Waki K., Yamagata H., Yamane H., Yoshiki S., Yoshihara R., Yukawa K.,
Zhong H., Iwama H., Endo T., Ito H., Hahn J.H., Kim H.-I., Eun M.-Y.,
Yano M., Jiang J., Gojobori T.;
"The genome sequence and structure of rice chromosome 1.";
Nature 420:312-316(2002).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Nipponbare;
PubMed=16100779; DOI=10.1038/nature03895;
International rice genome sequencing project (IRGSP);
"The map-based sequence of the rice genome.";
Nature 436:793-800(2005).
[5]
GENOME REANNOTATION.
STRAIN=cv. Nipponbare;
PubMed=18089549; DOI=10.1093/nar/gkm978;
The rice annotation project (RAP);
"The rice annotation project database (RAP-DB): 2008 update.";
Nucleic Acids Res. 36:D1028-D1033(2008).
[6]
GENOME REANNOTATION.
STRAIN=cv. Nipponbare;
PubMed=24280374; DOI=10.1186/1939-8433-6-4;
Kawahara Y., de la Bastide M., Hamilton J.P., Kanamori H.,
McCombie W.R., Ouyang S., Schwartz D.C., Tanaka T., Wu J., Zhou S.,
Childs K.L., Davidson R.M., Lin H., Quesada-Ocampo L.,
Vaillancourt B., Sakai H., Lee S.S., Kim J., Numa H., Itoh T.,
Buell C.R., Matsumoto T.;
"Improvement of the Oryza sativa Nipponbare reference genome using
next generation sequence and optical map data.";
Rice 6:4-4(2013).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Nipponbare;
PubMed=15685292; DOI=10.1371/journal.pbio.0030038;
Yu J., Wang J., Lin W., Li S., Li H., Zhou J., Ni P., Dong W., Hu S.,
Zeng C., Zhang J., Zhang Y., Li R., Xu Z., Li S., Li X., Zheng H.,
Cong L., Lin L., Yin J., Geng J., Li G., Shi J., Liu J., Lv H., Li J.,
Wang J., Deng Y., Ran L., Shi X., Wang X., Wu Q., Li C., Ren X.,
Wang J., Wang X., Li D., Liu D., Zhang X., Ji Z., Zhao W., Sun Y.,
Zhang Z., Bao J., Han Y., Dong L., Ji J., Chen P., Wu S., Liu J.,
Xiao Y., Bu D., Tan J., Yang L., Ye C., Zhang J., Xu J., Zhou Y.,
Yu Y., Zhang B., Zhuang S., Wei H., Liu B., Lei M., Yu H., Li Y.,
Xu H., Wei S., He X., Fang L., Zhang Z., Zhang Y., Huang X., Su Z.,
Tong W., Li J., Tong Z., Li S., Ye J., Wang L., Fang L., Lei T.,
Chen C.-S., Chen H.-C., Xu Z., Li H., Huang H., Zhang F., Xu H.,
Li N., Zhao C., Li S., Dong L., Huang Y., Li L., Xi Y., Qi Q., Li W.,
Zhang B., Hu W., Zhang Y., Tian X., Jiao Y., Liang X., Jin J., Gao L.,
Zheng W., Hao B., Liu S.-M., Wang W., Yuan L., Cao M., McDermott J.,
Samudrala R., Wang J., Wong G.K.-S., Yang H.;
"The genomes of Oryza sativa: a history of duplications.";
PLoS Biol. 3:266-281(2005).
[8]
FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND INDUCTION.
PubMed=17293435; DOI=10.1104/pp.106.094532;
Dai X., Xu Y., Ma Q., Xu W., Wang T., Xue Y., Chong K.;
"Overexpression of an R1R2R3 MYB gene, OsMYB3R-2, increases tolerance
to freezing, drought, and salt stress in transgenic Arabidopsis.";
Plant Physiol. 143:1739-1751(2007).
[9]
FUNCTION.
PubMed=19279197; DOI=10.1104/pp.108.133454;
Ma Q., Dai X., Xu Y., Guo J., Liu Y., Chen N., Xiao J., Zhang D.,
Xu Z., Zhang X., Chong K.;
"Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is
mediated by alteration in cell cycle and ectopic expression of stress
genes.";
Plant Physiol. 150:244-256(2009).
-!- FUNCTION: Transcription factor involved in abiotic stress
responses (PubMed:17293435, PubMed:19279197). May play a
regulatory role in tolerance to salt, cold, and drought stresses
(PubMed:17293435). Transcriptional activator that binds
specifically to a mitosis-specific activator cis-element 5'-
(T/C)C(T/C)AACGG(T/C)(T/C)A-3', found in promoters of cyclin genes
such as CYCB1-1 and KNOLLE (AC Q84R43). Positively regulates a
subset of G2/M phase-specific genes, including CYCB1-1, CYCB2-1,
CYCB2-2, and CDC20.1 in response to cold treatment
(PubMed:19279197). {ECO:0000269|PubMed:17293435,
ECO:0000269|PubMed:19279197}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-
ProRule:PRU00625, ECO:0000269|PubMed:17293435}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q0JHU7-1; Sequence=Displayed;
Name=2;
IsoId=Q0JHU7-2; Sequence=VSP_058917;
Note=No experimental confirmation available. {ECO:0000305};
-!- TISSUE SPECIFICITY: Expressed in roots, leaves, stems and spikes.
{ECO:0000269|PubMed:17293435}.
-!- INDUCTION: Induced by cold, drought and salt stresses.
{ECO:0000269|PubMed:17293435}.
-!- MISCELLANEOUS: Plants over-expressing MYB3R-2 show increased
tolerance to freezing (PubMed:19279197). Plants over-expressing
MYB3R-2 show retarded growth, increased tolerance to cold, drought
and salt stresses, and have decreased sensitivity to seed
germination inhibition by abscisic acid (ABA) or salt
(PubMed:17293435). {ECO:0000269|PubMed:17293435,
ECO:0000269|PubMed:19279197}.
-!- SEQUENCE CAUTION:
Sequence=BAD81765.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=EEE55651.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AJ430052; CAD22534.1; -; mRNA.
EMBL; FJ940212; ADB84634.1; -; mRNA.
EMBL; FJ940219; ADB84641.1; -; mRNA.
EMBL; AP003241; BAD81765.1; ALT_INIT; Genomic_DNA.
EMBL; AP008207; BAF06681.1; -; Genomic_DNA.
EMBL; AP014957; BAS75160.1; -; Genomic_DNA.
EMBL; CM000138; EEE55651.1; ALT_INIT; Genomic_DNA.
RefSeq; XP_015616493.1; XM_015761007.1. [Q0JHU7-1]
RefSeq; XP_015616500.1; XM_015761014.1. [Q0JHU7-1]
UniGene; Os.38177; -.
SMR; Q0JHU7; -.
STRING; 39947.LOC_Os01g62410.1; -.
PaxDb; Q0JHU7; -.
EnsemblPlants; Os01t0841500-01; Os01t0841500-01; Os01g0841500. [Q0JHU7-1]
GeneID; 4327399; -.
Gramene; Os01t0841500-01; Os01t0841500-01; Os01g0841500. [Q0JHU7-1]
KEGG; osa:4327399; -.
eggNOG; KOG0048; Eukaryota.
eggNOG; COG5147; LUCA.
KO; K09422; -.
OMA; AMVEQEG; -.
OrthoDB; EOG093605AA; -.
Proteomes; UP000059680; Chromosome 1.
ExpressionAtlas; Q0JHU7; baseline and differential.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0043565; F:sequence-specific DNA binding; IDA:UniProtKB.
GO; GO:0001135; F:transcription factor activity, RNA polymerase II transcription factor recruiting; IBA:GO_Central.
GO; GO:0044212; F:transcription regulatory region DNA binding; IBA:GO_Central.
GO; GO:0030154; P:cell differentiation; IBA:GO_Central.
GO; GO:1901002; P:positive regulation of response to salt stress; IMP:UniProtKB.
GO; GO:1902584; P:positive regulation of response to water deprivation; IMP:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0006357; P:regulation of transcription by RNA polymerase II; IBA:GO_Central.
GO; GO:0009409; P:response to cold; IMP:UniProtKB.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
CDD; cd00167; SANT; 3.
InterPro; IPR009057; Homeobox-like_sf.
InterPro; IPR017930; Myb_dom.
InterPro; IPR001005; SANT/Myb.
Pfam; PF00249; Myb_DNA-binding; 3.
SMART; SM00717; SANT; 3.
SUPFAM; SSF46689; SSF46689; 2.
PROSITE; PS51294; HTH_MYB; 3.
2: Evidence at transcript level;
Alternative splicing; Complete proteome; DNA-binding; Nucleus;
Reference proteome; Repeat; Stress response; Transcription;
Transcription regulation.
CHAIN 1 587 Transcription factor MYB3R-2.
/FTId=PRO_0000439824.
DOMAIN 62 113 HTH myb-type 1. {ECO:0000255|PROSITE-
ProRule:PRU00625}.
DOMAIN 114 169 HTH myb-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00625}.
DOMAIN 170 220 HTH myb-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00625}.
DNA_BIND 90 113 H-T-H motif. {ECO:0000255|PROSITE-
ProRule:PRU00625}.
DNA_BIND 142 165 H-T-H motif. {ECO:0000255|PROSITE-
ProRule:PRU00625}.
DNA_BIND 193 216 H-T-H motif. {ECO:0000255|PROSITE-
ProRule:PRU00625}.
COMPBIAS 22 54 Ser-rich. {ECO:0000255|PROSITE-
ProRule:PRU00016}.
VAR_SEQ 1 93 MGAMAMVEQEGCVENRQPLAASSSSVSDGSSYGGGGGGLAQ
MSPPVSSSANSISGLRRTSGPIRRAKGGWTPEEDETLRKAV
EAYKGRNWKKI -> MYLYA (in isoform 2).
/FTId=VSP_058917.
CONFLICT 199 199 V -> A (in Ref. 2; ADB84641 and 1;
CAD22534). {ECO:0000305}.
CONFLICT 460 460 E -> G (in Ref. 2; ADB84641 and 1;
CAD22534). {ECO:0000305}.
CONFLICT 472 472 Y -> H (in Ref. 2; ADB84641 and 1;
CAD22534). {ECO:0000305}.
SEQUENCE 587 AA; 64100 MW; 77C569D47EB8A3F2 CRC64;
MGAMAMVEQE GCVENRQPLA ASSSSVSDGS SYGGGGGGLA QMSPPVSSSA NSISGLRRTS
GPIRRAKGGW TPEEDETLRK AVEAYKGRNW KKIAECFPYR TEVQCLHRWQ KVLNPELIKG
PWTQEEDDQI IDLVKKYGPT KWSVIAKALP GRIGKQCRER WHNHLNPEIR KDAWTTEEEQ
ALINAHRIYG NKWAEIAKVL PGRTDNSIKN HWNSSLRKKQ DMYNTSNNMV VPKLLVHDKF
KDKPKLMAME GHLDLNKAPI INSKDQPGTA HRSNCSGFLS RSSLPTAQPL TSREASVVDG
SAVTLVAQAL ESDSVRGKGL EIDSVHEKGL EVNSAPDHTG NSWTIQLEAA PSKGEAELSL
KNEARSLGPL CYQIPNMEDV VPVSSSLFSD HLTGNHTSEH CGDDILSPAG CTTPPPTKGK
LTSQLSVDSI LKSAANSFPG TPSILKRRKR DKSTPVSASE MKISGSNTDR FYTPMGMEPA
TATPESFKTT SFLSLGSLDG SVKSFDVSPQ YRARSKRMAL TKTVEKQLDF SSDGLDTCGS
EILNSSCNNS QSTLSITEAP KLKEKEHAVQ LENLTKNFAH TTNLDVT


Related products :

Catalog number Product name Quantity
EIAAB13406 ETS translocation variant 7,ETS-related protein Tel2,ETV7,Homo sapiens,Human,TEL2,TELB,Tel-related Ets factor,Transcription factor ETV7,Transcription factor Tel-2,TREF
27-546 Forkhead Box Protein E3 (FOXE3, forkhead-related protein FKHL12, forkhead-related transcription factor 8) is a forkhead_winged helix transcription factor, which is expressed in the developing lens fro 0.05 mg
EIAAB25068 Liver regeneration-related protein LRRG00119,Morf4l2,MORF-related gene X protein,Mortality factor 4-like protein 2,Rat,Rattus norvegicus,Transcription factor-like protein MRGX
18-003-43311 Ets-related transcription factor - E74-like factor 3 (Ets domain transcription factor. epithelial-specific ); Epthelial-specific ets protein; ESE-1b; ESX; ELF3 protein; Epithelium-restricted Ets prote 0.1 mg Protein A
EIAAB12788 E74-like factor 5,ELF5,Epithelium-restricted ESE-1-related Ets factor,Epithelium-specific Ets transcription factor 2,ESE2,ESE-2,ETS-related transcription factor Elf-5,Homo sapiens,Human
18-003-42111 Transcription factor CP2-like protein 1 - CP2-related transcriptional repressor 1; CRTR-1; Transcription factor LBP-9 Polyclonal 0.05 mg Aff Pur
18-003-43083 Transcription factor CP2-like protein 1 - CP2-related transcriptional repressor 1; CRTR-1; Transcription factor LBP-9 Polyclonal 0.05 mg Aff Pur
EIAAB42056 CP2-related transcriptional repressor 1,CRTR1,CRTR-1,Homo sapiens,Human,LBP9,TFCP2L1,Transcription factor CP2-like protein 1,Transcription factor LBP-9
EIAAB41323 DN-7,Homo sapiens,Human,Neuronal cell death-related protein 7,TAF9B,TAF9L,Transcription initiation factor TFIID subunit 9B,Transcription initiation factor TFIID subunit 9-like,Transcription-associated
EIAAB11483 Dmrt8.1,Dmrtc1,Dmrtc1a,Doublesex- and mab-3-related transcription factor 8.1,Doublesex- and mab-3-related transcription factor C1,Mouse,Mus musculus
EIAAB11489 DMRT5,DMRTA2,Doublesex- and mab-3-related transcription factor 5,Doublesex- and mab-3-related transcription factor A2,Homo sapiens,Human
EIAAB24887 Basic SAP coiled-coil transcription activator,Bsac,Megakaryoblastic leukemia 1 protein homolog,MKL_myocardin-like protein 1,Mkl1,Mouse,MRTF-A,Mus musculus,Myocardin-related transcription factor A
18-003-43465 ETS-related transcription factor Elf-3 - E74-like factor 3; Epithelium-specific Ets transcription factor 1; ESE-1; Epithelium-restricted Ets protein ESX; Epithelial-restricted with serine box Polyclon 0.05 mg Aff Pur
EIAAB12783 E74-like factor 3,Elf3,Epithelial-restricted with serine box,Epithelium-restricted Ets protein ESX,Epithelium-specific Ets transcription factor 1,Ert,ESE-1,Esx,ETS-related transcription factor Elf-3,J
EIAAB12782 E74-like factor 3,ELF3,Epithelial-restricted with serine box,Epithelium-restricted Ets protein ESX,Epithelium-specific Ets transcription factor 1,ERT,ESE-1,ESX,ETS-related transcription factor Elf-3,H
EIAAB11488 Dmrt7,Dmrtc2,Doublesex- and mab-3-related transcription factor 7,Doublesex- and mab-3-related transcription factor C2,Mouse,Mus musculus
EIAAB11491 Bos taurus,Bovine,DMRT5,DMRTA2,Doublesex- and mab-3-related transcription factor 5,Doublesex- and mab-3-related transcription factor A2
EIAAB11490 Dmrt5,Dmrta2,Doublesex- and mab-3-related transcription factor 5,Doublesex- and mab-3-related transcription factor A2,Mouse,Mus musculus
EIAAB11480 Dmrt4,Dmrta1,Doublesex- and mab-3-related transcription factor 4,Doublesex- and mab-3-related transcription factor A1,Mouse,Mus musculus
EIAAB11481 Dmrt6,Dmrtb1,Doublesex- and mab-3-related transcription factor 6,Doublesex- and mab-3-related transcription factor B1,Mouse,Mus musculus
18-003-42297 Mortality factor 4-like protein 1 - MORF-related gene 15 protein; Transcription factor-like protein MRG15; MSL3-1 protein Polyclonal 0.1 mg Protein A
18-003-42425 Mortality factor 4-like protein 2 - MORF-related gene X protein; Transcription factor-like protein MRGX; MSL3-2 protein Polyclonal 0.1 mg Protein A
EIAAB25067 Morf4l1,MORF-related gene 15 protein,Mortality factor 4-like protein 1,Rat,Rattus norvegicus,Transcription factor-like protein MRG15
EIAAB25069 Kiaa0026,Morf4l2,MORF-related gene X protein,Mortality factor 4-like protein 2,Mouse,Mus musculus,Sid 393,Sid393,Transcription factor-like protein MRGX
18-003-43151 Forkhead box protein D1 - Forkhead-related protein FKHL8; Forkhead-related transcription factor 4; FREAC-4; Brain factor 2; HFH-BF-2 Polyclonal 0.05 mg Aff Pur


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur