Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Troponin I (Tn I) (Protein heldup) (Protein wings apart-A)

 TNNI_DROME              Reviewed;         269 AA.
P36188; Q0KHR0; Q9VWY1; Q9VWY2; Q9VWY3; Q9VWY4;
01-JUN-1994, integrated into UniProtKB/Swiss-Prot.
23-JAN-2007, sequence version 3.
25-OCT-2017, entry version 153.
RecName: Full=Troponin I;
Short=Tn I;
AltName: Full=Protein heldup;
AltName: Full=Protein wings apart-A;
Name=wupA; Synonyms=HDP, TnI; ORFNames=CG7178;
Drosophila melanogaster (Fruit fly).
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
Ephydroidea; Drosophilidae; Drosophila; Sophophora.
NCBI_TaxID=7227;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 2
AND 9), AND FUNCTION.
STRAIN=Canton-S; TISSUE=Embryo, and Larva;
PubMed=1899228; DOI=10.1101/gad.5.1.132;
Barbas J.A., Galceran J., Krah-Jentgens I., de la Pompa J.L.,
Canal I., Pongs O., Ferrus A.;
"Troponin I is encoded in the haplolethal region of the Shaker gene
complex of Drosophila.";
Genes Dev. 5:132-140(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6).
STRAIN=Oregon-R; TISSUE=Pupae;
PubMed=1908472; DOI=10.1083/jcb.114.5.941;
Beall C.J., Fyrberg E.;
"Muscle abnormalities in Drosophila melanogaster heldup mutants are
caused by missing or aberrant troponin-I isoforms.";
J. Cell Biol. 114:941-951(1991).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Berkeley;
PubMed=10731132; DOI=10.1126/science.287.5461.2185;
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
"The genome sequence of Drosophila melanogaster.";
Science 287:2185-2195(2000).
[4]
GENOME REANNOTATION, AND ALTERNATIVE SPLICING.
STRAIN=Berkeley;
PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
Lewis S.E.;
"Annotation of the Drosophila melanogaster euchromatic genome: a
systematic review.";
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 8).
STRAIN=Berkeley; TISSUE=Head;
PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M.,
George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H.,
Rubin G.M., Celniker S.E.;
"A Drosophila full-length cDNA resource.";
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
[6]
ALTERNATIVE SPLICING, TISSUE SPECIFICITY, AND DEVELOPMENTAL STAGE.
PubMed=7680094; DOI=10.1128/MCB.13.3.1433;
Barbas J.A., Galceran J., Torroja L., Prado A., Ferrus A.;
"Abnormal muscle development in the heldup3 mutant of Drosophila
melanogaster is caused by a splicing defect affecting selected
troponin I isoforms.";
Mol. Cell. Biol. 13:1433-1439(1993).
-!- FUNCTION: Troponin I is the ATPase inhibitory subunit of troponin
in the thin filament regulatory complex. Involved in the
development and maintenance of muscle and nervous system. May also
be involved in the cytoskeletal apparatus.
{ECO:0000269|PubMed:1899228}.
-!- SUBUNIT: Binds to actin and tropomyosin.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=10;
Comment=Exon 3 is either present or absent, exon 6 has 4
mutually exclusive forms (6a1, 6a2, 6b1 and 6b2) and C-terminal
exons 9 and 10 are mutually exclusive.;
Name=10; Synonyms=G;
IsoId=P36188-1; Sequence=Displayed;
Name=1;
IsoId=P36188-2; Sequence=VSP_006626, VSP_006627, VSP_006630;
Name=2; Synonyms=A;
IsoId=P36188-3; Sequence=VSP_006626, VSP_006627;
Name=3;
IsoId=P36188-4; Sequence=VSP_006626, VSP_006628, VSP_006630;
Name=4; Synonyms=B;
IsoId=P36188-5; Sequence=VSP_006626, VSP_006628;
Name=5;
IsoId=P36188-6; Sequence=VSP_006626, VSP_006630;
Name=6; Synonyms=C, F;
IsoId=P36188-7; Sequence=VSP_006626;
Name=7;
IsoId=P36188-8; Sequence=VSP_006626, VSP_006629, VSP_006630;
Name=8; Synonyms=D, E;
IsoId=P36188-9; Sequence=VSP_006626, VSP_006629;
Name=9;
IsoId=P36188-10; Sequence=VSP_006630;
-!- TISSUE SPECIFICITY: All isoforms are expressed in somatic muscle.
Isoforms containing exon 6a1 (isoforms 1 and 2) are expressed in
all muscles but highest expression is in abdominal muscle and
splanchnic muscle of the gut. Isoforms containing exon 6b1
(isoforms 5, 6, 9 and 10) are highly expressed in the tergal
depressor of trochanter (TDT) muscle.
{ECO:0000269|PubMed:7680094}.
-!- DEVELOPMENTAL STAGE: Isoforms containing exon 3 (isoform 9 and
isoform 10) are expressed in adults. Isoforms containing exon 6a1
(isoforms 1 and 2) are expressed at all developmental stages.
Isoforms containing exon 6a2 (isoforms 3 and 4) are weakly
expressed in embryos and larvae and very weakly in adults.
Isoforms containing exon 6b1 (isoforms 5, 6, 9 and 10) are weakly
expressed in larva and increase during metamorphosis. Isoforms
containing exon 6b2 (isoforms 7 and 8) are weakly expressed in
embryos and larvae and at a higher level in adults.
{ECO:0000269|PubMed:7680094}.
-!- SIMILARITY: Belongs to the troponin I family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; X58188; CAA41171.1; -; Genomic_DNA.
EMBL; X59376; CAA42020.1; -; mRNA.
EMBL; AE014298; AAF48802.2; -; Genomic_DNA.
EMBL; AE014298; AAF48803.2; -; Genomic_DNA.
EMBL; AE014298; AAF48804.2; -; Genomic_DNA.
EMBL; AE014298; AAN09458.1; -; Genomic_DNA.
EMBL; AE014298; AAN09460.1; -; Genomic_DNA.
EMBL; AY122145; AAM52657.1; -; mRNA.
PIR; A38594; A38594.
PIR; A40547; A40547.
PIR; A48147; A48147.
PIR; B38594; B38594.
PIR; B48147; B48147.
PIR; C48147; C48147.
PIR; D48147; D48147.
RefSeq; NP_523398.1; NM_078674.4. [P36188-7]
RefSeq; NP_728137.1; NM_167603.3. [P36188-7]
RefSeq; NP_728138.1; NM_167604.4. [P36188-9]
RefSeq; NP_728139.1; NM_167605.3. [P36188-9]
RefSeq; NP_728140.1; NM_167606.3. [P36188-5]
RefSeq; NP_728141.1; NM_167607.3. [P36188-3]
RefSeq; NP_728142.1; NM_167608.3. [P36188-1]
UniGene; Dm.1717; -.
ProteinModelPortal; P36188; -.
SMR; P36188; -.
BioGrid; 59114; 48.
DIP; DIP-22750N; -.
IntAct; P36188; 8.
STRING; 7227.FBpp0074298; -.
PaxDb; P36188; -.
PeptideAtlas; P36188; -.
PRIDE; P36188; -.
EnsemblMetazoa; FBtr0074520; FBpp0074294; FBgn0004028. [P36188-3]
EnsemblMetazoa; FBtr0074521; FBpp0074295; FBgn0004028. [P36188-5]
EnsemblMetazoa; FBtr0074522; FBpp0074296; FBgn0004028. [P36188-7]
EnsemblMetazoa; FBtr0074523; FBpp0074297; FBgn0004028. [P36188-9]
EnsemblMetazoa; FBtr0074524; FBpp0074298; FBgn0004028. [P36188-1]
EnsemblMetazoa; FBtr0074525; FBpp0074299; FBgn0004028. [P36188-7]
EnsemblMetazoa; FBtr0074526; FBpp0074300; FBgn0004028. [P36188-9]
EnsemblMetazoa; FBtr0308235; FBpp0300555; FBgn0004028. [P36188-10]
EnsemblMetazoa; FBtr0308236; FBpp0300556; FBgn0004028. [P36188-8]
EnsemblMetazoa; FBtr0308237; FBpp0300557; FBgn0004028. [P36188-2]
GeneID; 32794; -.
KEGG; dme:Dmel_CG7178; -.
CTD; 32794; -.
FlyBase; FBgn0283471; wupA.
eggNOG; KOG3977; Eukaryota.
eggNOG; ENOG410Y9IX; LUCA.
GeneTree; ENSGT00730000112188; -.
InParanoid; P36188; -.
OMA; KMFDTGG; -.
OrthoDB; EOG091G1571; -.
PhylomeDB; P36188; -.
ChiTaRS; wupA; fly.
GenomeRNAi; 32794; -.
PRO; PR:P36188; -.
Proteomes; UP000000803; Chromosome X.
Bgee; FBgn0004028; -.
ExpressionAtlas; P36188; differential.
Genevisible; P36188; DM.
GO; GO:0005861; C:troponin complex; IBA:GO_Central.
GO; GO:0003779; F:actin binding; NAS:UniProtKB.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0048738; P:cardiac muscle tissue development; IMP:FlyBase.
GO; GO:0007629; P:flight behavior; IMP:FlyBase.
GO; GO:0060047; P:heart contraction; IMP:FlyBase.
GO; GO:0007507; P:heart development; IMP:FlyBase.
GO; GO:0046716; P:muscle cell cellular homeostasis; IMP:FlyBase.
GO; GO:0006936; P:muscle contraction; IBA:GO_Central.
GO; GO:0007517; P:muscle organ development; IMP:UniProtKB.
GO; GO:0030239; P:myofibril assembly; IMP:FlyBase.
GO; GO:0007399; P:nervous system development; IMP:UniProtKB.
GO; GO:0000280; P:nuclear division; IMP:FlyBase.
GO; GO:0045214; P:sarcomere organization; IMP:FlyBase.
GO; GO:0007519; P:skeletal muscle tissue development; IMP:FlyBase.
InterPro; IPR001978; Troponin.
Pfam; PF00992; Troponin; 1.
2: Evidence at transcript level;
Acetylation; Actin-binding; Alternative splicing; Calcium;
Complete proteome; Metal-binding; Methylation; Muscle protein;
Reference proteome.
INIT_MET 1 1 Removed. {ECO:0000250}.
CHAIN 2 269 Troponin I.
/FTId=PRO_0000186159.
CA_BIND 197 208 {ECO:0000250}.
REGION 162 171 Troponin T-interaction. {ECO:0000250}.
REGION 189 202 Actin-binding. {ECO:0000250}.
MOD_RES 2 2 N-acetylalanine. {ECO:0000250}.
MOD_RES 201 201 N6,N6,N6-trimethyllysine. {ECO:0000250}.
MOD_RES 205 205 N6,N6,N6-trimethyllysine. {ECO:0000250}.
VAR_SEQ 6 66 Missing (in isoform 1, isoform 2, isoform
3, isoform 4, isoform 5, isoform 6,
isoform 7 and isoform 8).
{ECO:0000303|PubMed:12537569,
ECO:0000303|PubMed:1908472}.
/FTId=VSP_006626.
VAR_SEQ 151 183 GELQEICEEYYERMYICEGQKWDLEYEVRKKDW -> DTLK
SLIKQHYDRINKLEDQKYDLEYVVKRKDV (in isoform
1 and isoform 2). {ECO:0000305}.
/FTId=VSP_006627.
VAR_SEQ 151 183 GELQEICEEYYERMYICEGQKWDLEYEVRKKDW -> DTIQ
SVCKDYHSKILKLESEKYDFEYDVARKDY (in isoform
3 and isoform 4). {ECO:0000305}.
/FTId=VSP_006628.
VAR_SEQ 151 183 GELQEICEEYYERMYICEGQKWDLEYEVRKKDW -> AELQ
TICKQYWQRVYSLEGDKFDLEHVQKVKAQ (in isoform
7 and isoform 8).
{ECO:0000303|PubMed:12537569}.
/FTId=VSP_006629.
VAR_SEQ 249 269 PDWSKGKPGDAKVKEEVEAEA -> IKDAAVLNKAKK (in
isoform 1, isoform 3, isoform 5, isoform
7 and isoform 9). {ECO:0000305}.
/FTId=VSP_006630.
SEQUENCE 269 AA; 30082 MW; 21A48CC974ED0D6F CRC64;
MADDEKKAAA PAAAPAAAAK PAAPAAAPAA NGKAAPAANG KAAPAAAAAP AGPPKDPNDP
KVKAEEAKKA KQAEIERKRA EVRKRMEEAS KAKKAKKGFM TPERKKKLRL LLRKKAAEEL
KKEQERKAAE RRRIIEERCG SPRNLSDASE GELQEICEEY YERMYICEGQ KWDLEYEVRK
KDWEINDLNA QVNDLRGKFV KPALKKVSKY ENKFAKLQKK AAEFNFRNQL KVVKKKEFTL
EEEEKEKKPD WSKGKPGDAK VKEEVEAEA


Related products :

Catalog number Product name Quantity
EIAAB46071 FOE,Friend of EBNA2 protein,Homo sapiens,Human,KIAA0261,WAPAL,WAPL,Wings apart-like protein homolog
E2993h Human Wings Apart Like Protein ELISA Kit 96T
E1230p Human ELISA Kit FOR Wings apart-like protein homolog 96T
CSB-EL025964MO Mouse Wings apart-like protein homolog(WAPAL) ELISA kit 96T
CSB-EL025964HU Human Wings apart-like protein homolog(WAPAL) ELISA kit 96T
I2815 Wings apart-like protein homolog (WAPAL), Human, ELISA Kit 96T
I2816 Wings apart-like protein homolog (WAPAL), Mouse, ELISA Kit 96T
CSB-EL025964MO Mouse Wings apart-like protein homolog(WAPAL) ELISA kit SpeciesMouse 96T
CSB-EL025964HU Human Wings apart-like protein homolog(WAPAL) ELISA kit SpeciesHuman 96T
EIAAB46072 DIF-2,Dioxin-inducible factor 2,Kiaa0261,Mouse,Mus musculus,Wapal,Wapl,Wings apart-like protein homolog
orb81433 Human Cardiac Troponin I-C Complex protein Troponin Complex is heteromeric protein playing an important role in the regulation of skeletal and cardiac muscle contraction. It consists of three subunits 2
orb81432 Human fast skeletal Troponin 1 protein Skelatal isoforms of Troponin were suggested to be used as markers of acute and chronic skelatal muscle injuries. In skelatal muscles Troponin is presented by tw 5
30-256 FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the ey 0.05 mg
orb81328 Rabbit Skeletal Muscle Troponin-C protein Rabbit Skeletal Muscle Troponin-C is a single, glycosylated, polypeptide chain having a molecular mass of 18,096 Dalton. Troponin-C is one of three subunits t 1 mg
orb81438 Human Cardiac Troponin-T protein Human Cardiac Troponin produced from Human Cardiac Tissue, having molecular weight of approximately 35 kDa.The Cardiac troponin-T is purified using combination of ion- 10
orb82254 Troponin I - Skeletal protein Troponin I-Skeletal >95 percent Pure is a purified cardiac marker. For research use only. 100
orb82213 Troponin Complex (I-T-C)(1 1 1) protein Troponin Complex (I-T-C)(1 1 1 Mixture) is a purified cardiac marker. For research use only. 100
orb82234 Rat Troponin T-Skeletal protein Troponin T-Skeletal, Rat is a purified cardiac marker. For research use only. 100
orb82225 Rat Troponin I-Skeletal protein Troponin I-Skeletal, Rat is a purified cardiac marker. For research use only. 100
orb82237 Rat Troponin C protein Troponin Cardiac Rat is a purified cardiac marker. For research use only. 100
orb82260 Troponin I-Cardiac Calib. Set protein Troponin I-Cardiac, Calibrator Set (NHS base) is a purified cardiac marker. For research use only. 1 set
orb80982 Rat Calbindin-1 protein Calbindins are Ca-binding proteins belonging to the troponin superfamily. CALB28K_Calbindin1_CALB1 (D28K_Spot35 protein or cholecalcin, rat 261 aa; mouse 261 aa; human 261-aa, 1
orb82259 Troponin C-Cardiac protein Troponin C-Cardiac >98 percent Pure is a purified cardiac marker. For research use only. 100
9202-1107 NATIVE HUMAN TROPONIN T, Product Type Purified Protein, Specificity TROPONIN T, Target Species Human, Host N_A, Format Purified, Isotypes , Applications E, Clone 50 µg
SCH-9202-1107 NATIVE HUMAN TROPONIN T, Product Type Purified Protein, Specificity TROPONIN T, Target Species Human, Host N_A, Format Purified, Isotypes , Applications E, Clone 50 µg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur