Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Tumor necrosis factor receptor superfamily member 25 (Apo-3) (Apoptosis-inducing receptor AIR) (Apoptosis-mediating receptor DR3) (Apoptosis-mediating receptor TRAMP) (Death receptor 3) (Lymphocyte-associated receptor of death) (LARD) (Protein WSL) (Protein WSL-1)

 TNR25_HUMAN             Reviewed;         417 AA.
Q93038; B1ALX2; B1ALX3; B7ZLL7; O00275; O00276; O00277; O00278;
O00279; O00280; O14865; O14866; P78507; P78515; Q17RU4; Q92983;
Q93036; Q93037; Q99722; Q99830; Q99831; Q9BY86; Q9UME0; Q9UME1;
Q9UME5;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
01-NOV-1997, sequence version 2.
25-OCT-2017, entry version 171.
RecName: Full=Tumor necrosis factor receptor superfamily member 25;
AltName: Full=Apo-3;
AltName: Full=Apoptosis-inducing receptor AIR;
AltName: Full=Apoptosis-mediating receptor DR3;
AltName: Full=Apoptosis-mediating receptor TRAMP;
AltName: Full=Death receptor 3;
AltName: Full=Lymphocyte-associated receptor of death;
Short=LARD;
AltName: Full=Protein WSL;
AltName: Full=Protein WSL-1;
Flags: Precursor;
Name=TNFRSF25; Synonyms=APO3, DDR3, DR3, TNFRSF12, WSL, WSL1;
ORFNames=UNQ455/PRO779;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), AND MUTAGENESIS.
TISSUE=Lymphoid tissue;
PubMed=8934525; DOI=10.1038/384372a0;
Kitson J., Raven T., Jiang Y.-P., Goeddel D.V., Giles K.M., Pun K.-T.,
Grinham C.J., Brown R., Farrow S.N.;
"A death-domain-containing receptor that mediates apoptosis.";
Nature 384:372-375(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Umbilical vein endothelial cell;
PubMed=8875942; DOI=10.1126/science.274.5289.990;
Chinnaiyan A.M., O'Rourke K., Yu G.-L., Lyons R.H., Garg M.,
Duan D.R., Xing L., Gentz R., Ni J., Dixit V.M.;
"Signal transduction by DR3, a death domain-containing receptor
related to TNFR-1 and CD95.";
Science 274:990-992(1996).
[3]
NUCLEOTIDE SEQUENCE [MRNA].
Degli-Esposti M.A., Din W.S., Cosman D., Smith C.A., Goodwin R.G.;
Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Heart;
PubMed=8994832; DOI=10.1016/S0960-9822(02)70791-4;
Marsters S.A., Sheridan J.P., Donahue C.J., Pitti R.M., Gray C.L.,
Goddard A.D., Bauer K.D., Ashkenazi A.;
"Apo-3, a new member of the tumor necrosis factor receptor family,
contains a death domain and activates apoptosis and NF-kappa-B.";
Curr. Biol. 6:1669-1676(1996).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND
10).
PubMed=9114039; DOI=10.1073/pnas.94.9.4615;
Screaton G.R., Xu X.-N., Olsen A.L., Cowper A.E., Tan R.,
McMichael A.J., Bell J.I.;
"LARD: a new lymphoid-specific death domain containing receptor
regulated by alternative pre-mRNA splicing.";
Proc. Natl. Acad. Sci. U.S.A. 94:4615-4619(1997).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 11 AND 12).
PubMed=9446802; DOI=10.1006/bbrc.1997.7948;
Warzocha K., Ribeiro P., Charlot C., Renard N., Coiffier B.,
Salles G.;
"A new death receptor 3 isoform: expression in human lymphoid cell
lines and non-Hodgkin's lymphomas.";
Biochem. Biophys. Res. Commun. 242:376-379(1998).
[7]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1), AND VARIANT GLY-159.
Shiozawa S., Konishi Y., Murayama K., Mukae N., Yamamoto E.,
Hayashi S., Sato M., Shiozawa K., Tsukamoto Y.;
Submitted (NOV-2000) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[9]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS GLN-23; GLY-159 AND
ARG-254.
NIEHS SNPs program;
Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[12]
NUCLEOTIDE SEQUENCE [MRNA] OF 4-417.
TISSUE=Brain, and Fetal lung;
PubMed=9052839; DOI=10.1016/S1074-7613(00)80244-7;
Bodmer J.-L., Burns K., Schneider P., Hofmann K., Steiner V.,
Thome M., Bornand T., Hahne M., Schroeter M., Wilson A., French L.E.,
Browning J.L., Macdonald H.R., Tschopp J.;
"TRAMP, a novel apoptosis-mediating receptor with sequence homology to
tumor necrosis factor receptor 1 and Fas(Apo-1/CD95).";
Immunity 6:79-88(1997).
[13]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] OF 7-417.
TISSUE=Brain;
Chaudhary P.M., Hood L.E.;
Submitted (JAN-1997) to the EMBL/GenBank/DDBJ databases.
[14]
INTERACTION WITH BAG4.
PubMed=9915703; DOI=10.1126/science.283.5401.543;
Jiang Y., Woronicz J.D., Liu W., Goeddel D.V.;
"Prevention of constitutive TNF receptor 1 signaling by silencer of
death domains.";
Science 283:543-546(1999).
[15]
SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S).
PubMed=14759258; DOI=10.1186/gb-2004-5-2-r8;
Hillman R.T., Green R.E., Brenner S.E.;
"An unappreciated role for RNA surveillance.";
Genome Biol. 5:R8.1-R8.16(2004).
-!- FUNCTION: Receptor for TNFSF12/APO3L/TWEAK. Interacts directly
with the adapter TRADD. Mediates activation of NF-kappa-B and
induces apoptosis. May play a role in regulating lymphocyte
homeostasis.
-!- SUBUNIT: Homodimer. Interacts strongly via the death domains with
TNFRSF1 and TRADD to activate at least two distinct signaling
cascades, apoptosis and NF-kappa-B signaling. Interacts with BAG4.
{ECO:0000269|PubMed:9915703}.
-!- SUBCELLULAR LOCATION: Isoform 1: Cell membrane; Single-pass type I
membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 2: Cell membrane; Single-pass type I
membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 9: Cell membrane; Single-pass type I
membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 11: Cell membrane; Single-pass type
I membrane protein.
-!- SUBCELLULAR LOCATION: Isoform 3: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 4: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 5: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 6: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 7: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 8: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 10: Secreted.
-!- SUBCELLULAR LOCATION: Isoform 12: Secreted.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=12;
Name=1; Synonyms=WSL-1, LARD-1A;
IsoId=Q93038-1; Sequence=Displayed;
Name=2; Synonyms=LARD-1B;
IsoId=Q93038-2; Sequence=VSP_006504;
Name=3; Synonyms=WSL-S1, LARD-3;
IsoId=Q93038-3; Sequence=VSP_006497, VSP_006498;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=4; Synonyms=WSL-S2, LARD-2;
IsoId=Q93038-4; Sequence=VSP_006501, VSP_006502;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=5; Synonyms=LARD-4, LARD-11;
IsoId=Q93038-5; Sequence=VSP_006495;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=6; Synonyms=LARD-5;
IsoId=Q93038-6; Sequence=VSP_006491, VSP_006495;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=7; Synonyms=LARD-6;
IsoId=Q93038-7; Sequence=VSP_006491, VSP_006493, VSP_006494;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
Name=8; Synonyms=LARD-7;
IsoId=Q93038-8; Sequence=VSP_006492;
Name=9; Synonyms=LARD-8;
IsoId=Q93038-9; Sequence=VSP_006491;
Name=10; Synonyms=LARD-9;
IsoId=Q93038-10; Sequence=VSP_006503;
Name=11; Synonyms=Beta;
IsoId=Q93038-11; Sequence=VSP_006496;
Name=12; Synonyms=Beta soluble;
IsoId=Q93038-12; Sequence=VSP_006499, VSP_006500;
Note=May be produced at very low levels due to a premature stop
codon in the mRNA, leading to nonsense-mediated mRNA decay.;
-!- TISSUE SPECIFICITY: Abundantly expressed in thymocytes and
lymphocytes. Detected in lymphocyte-rich tissues such as thymus,
colon, intestine, and spleen. Also found in the prostate.
-!- PTM: Glycosylated. {ECO:0000305}.
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/tnfrsf25/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; Y09392; CAA70561.1; -; mRNA.
EMBL; Y09392; CAA70559.1; -; mRNA.
EMBL; Y09392; CAA70560.1; -; mRNA.
EMBL; U72763; AAC50819.1; -; mRNA.
EMBL; U83599; AAB41434.1; -; Genomic_DNA.
EMBL; U83600; AAB41435.1; -; Genomic_DNA.
EMBL; U78029; AAB40918.1; -; mRNA.
EMBL; U74611; AAB39714.1; -; mRNA.
EMBL; U94501; AAC51306.1; -; mRNA.
EMBL; U94504; AAC51309.1; -; mRNA.
EMBL; U94502; AAC51307.1; -; mRNA.
EMBL; U94503; AAC51308.1; -; mRNA.
EMBL; U94505; AAC51310.1; -; mRNA.
EMBL; U94506; AAC51311.1; -; mRNA.
EMBL; U94507; AAC51312.1; -; mRNA.
EMBL; U94508; AAC51313.1; -; mRNA.
EMBL; U94509; AAC51314.1; -; mRNA.
EMBL; U94510; AAC51315.1; -; mRNA.
EMBL; U94512; AAC51316.1; -; mRNA.
EMBL; U83598; AAB41433.1; -; mRNA.
EMBL; AF026070; AAC39556.1; -; mRNA.
EMBL; AF026071; AAB82288.1; -; mRNA.
EMBL; AB051850; BAB40662.1; -; Genomic_DNA.
EMBL; AB051851; BAB40663.1; -; Genomic_DNA.
EMBL; AY358309; AAQ88676.1; -; mRNA.
EMBL; AY254324; AAO63495.1; -; Genomic_DNA.
EMBL; U75380; AAC51192.1; -; mRNA.
EMBL; AL158217; CAI22153.1; -; Genomic_DNA.
EMBL; AL158217; CAI22154.1; -; Genomic_DNA.
EMBL; AL158217; CAI22155.1; -; Genomic_DNA.
EMBL; BC117189; AAI17190.1; -; mRNA.
EMBL; BC143886; AAI43887.1; -; mRNA.
EMBL; U75381; AAC51193.1; -; mRNA.
EMBL; U83597; AAB41432.1; -; mRNA.
CCDS; CCDS71.1; -. [Q93038-1]
CCDS; CCDS72.1; -. [Q93038-11]
CCDS; CCDS73.1; -. [Q93038-10]
CCDS; CCDS74.1; -. [Q93038-9]
CCDS; CCDS75.1; -. [Q93038-8]
RefSeq; NP_001034753.1; NM_001039664.1. [Q93038-5]
RefSeq; NP_003781.1; NM_003790.2. [Q93038-1]
RefSeq; NP_683866.1; NM_148965.1. [Q93038-11]
RefSeq; NP_683867.1; NM_148966.1. [Q93038-10]
RefSeq; NP_683868.1; NM_148967.1. [Q93038-9]
RefSeq; NP_683871.1; NM_148970.1. [Q93038-8]
UniGene; Hs.462529; -.
ProteinModelPortal; Q93038; -.
SMR; Q93038; -.
BioGrid; 114258; 9.
DIP; DIP-59563N; -.
IntAct; Q93038; 1.
iPTMnet; Q93038; -.
BioMuta; TNFRSF25; -.
DMDM; 2501233; -.
PeptideAtlas; Q93038; -.
PRIDE; Q93038; -.
Ensembl; ENST00000348333; ENSP00000314451; ENSG00000215788. [Q93038-9]
Ensembl; ENST00000351748; ENSP00000326762; ENSG00000215788. [Q93038-8]
Ensembl; ENST00000351959; ENSP00000337713; ENSG00000215788. [Q93038-10]
Ensembl; ENST00000356876; ENSP00000349341; ENSG00000215788. [Q93038-1]
Ensembl; ENST00000377782; ENSP00000367013; ENSG00000215788. [Q93038-11]
Ensembl; ENST00000414040; ENSP00000404274; ENSG00000215788. [Q93038-3]
Ensembl; ENST00000485036; ENSP00000431554; ENSG00000215788. [Q93038-12]
Ensembl; ENST00000502588; ENSP00000423121; ENSG00000215788. [Q93038-6]
Ensembl; ENST00000502730; ENSP00000421976; ENSG00000215788. [Q93038-7]
Ensembl; ENST00000510563; ENSP00000424071; ENSG00000215788. [Q93038-5]
GeneID; 8718; -.
KEGG; hsa:8718; -.
UCSC; uc001ana.4; human. [Q93038-1]
CTD; 8718; -.
DisGeNET; 8718; -.
EuPathDB; HostDB:ENSG00000215788.9; -.
GeneCards; TNFRSF25; -.
HGNC; HGNC:11910; TNFRSF25.
HPA; HPA077620; -.
MIM; 603366; gene.
neXtProt; NX_Q93038; -.
OpenTargets; ENSG00000215788; -.
PharmGKB; PA36603; -.
GeneTree; ENSGT00530000064001; -.
HOVERGEN; HBG058493; -.
InParanoid; Q93038; -.
KO; K05160; -.
OMA; GWRQMFW; -.
OrthoDB; EOG091G07LE; -.
PhylomeDB; Q93038; -.
TreeFam; TF333916; -.
Reactome; R-HSA-5669034; TNFs bind their physiological receptors.
SIGNOR; Q93038; -.
ChiTaRS; TNFRSF25; human.
GeneWiki; TNFRSF25; -.
GenomeRNAi; 8718; -.
PRO; PR:Q93038; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000215788; -.
ExpressionAtlas; Q93038; baseline and differential.
Genevisible; Q93038; HS.
GO; GO:0005829; C:cytosol; NAS:UniProtKB.
GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell.
GO; GO:0005887; C:integral component of plasma membrane; TAS:ProtInc.
GO; GO:0005886; C:plasma membrane; IDA:MGI.
GO; GO:0004872; F:receptor activity; NAS:UniProtKB.
GO; GO:0005031; F:tumor necrosis factor-activated receptor activity; TAS:ProtInc.
GO; GO:0006915; P:apoptotic process; TAS:ProtInc.
GO; GO:0097190; P:apoptotic signaling pathway; TAS:ProtInc.
GO; GO:0007166; P:cell surface receptor signaling pathway; TAS:ProtInc.
GO; GO:0006955; P:immune response; IBA:GO_Central.
GO; GO:0006954; P:inflammatory response; IBA:GO_Central.
GO; GO:0007275; P:multicellular organism development; IBA:GO_Central.
GO; GO:0042981; P:regulation of apoptotic process; IBA:GO_Central.
GO; GO:0042127; P:regulation of cell proliferation; IBA:GO_Central.
GO; GO:0032496; P:response to lipopolysaccharide; IBA:GO_Central.
GO; GO:0007165; P:signal transduction; TAS:ProtInc.
GO; GO:0033209; P:tumor necrosis factor-mediated signaling pathway; TAS:Reactome.
CDD; cd13420; TNFRSF25; 1.
InterPro; IPR011029; DEATH-like_dom.
InterPro; IPR000488; Death_domain.
InterPro; IPR001368; TNFR/NGFR_Cys_rich_reg.
InterPro; IPR022329; TNFR_25.
InterPro; IPR034050; TNFRSF25_N.
Pfam; PF00531; Death; 1.
Pfam; PF00020; TNFR_c6; 1.
PRINTS; PR01972; TNFACTORR25.
SMART; SM00005; DEATH; 1.
SMART; SM00208; TNFR; 2.
SUPFAM; SSF47986; SSF47986; 1.
PROSITE; PS50017; DEATH_DOMAIN; 1.
PROSITE; PS00652; TNFR_NGFR_1; 2.
PROSITE; PS50050; TNFR_NGFR_2; 1.
1: Evidence at protein level;
Alternative splicing; Apoptosis; Cell membrane; Complete proteome;
Disulfide bond; Glycoprotein; Membrane; Polymorphism; Receptor;
Reference proteome; Repeat; Secreted; Signal; Transmembrane;
Transmembrane helix.
SIGNAL 1 24 {ECO:0000255}.
CHAIN 25 417 Tumor necrosis factor receptor
superfamily member 25.
/FTId=PRO_0000034606.
TOPO_DOM 25 199 Extracellular. {ECO:0000255}.
TRANSMEM 200 220 Helical. {ECO:0000255}.
TOPO_DOM 221 417 Cytoplasmic. {ECO:0000255}.
REPEAT 34 71 TNFR-Cys 1.
REPEAT 72 115 TNFR-Cys 2.
REPEAT 116 163 TNFR-Cys 3.
REPEAT 164 192 TNFR-Cys 4.
DOMAIN 332 413 Death. {ECO:0000255|PROSITE-
ProRule:PRU00064}.
CARBOHYD 67 67 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 106 106 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 35 47 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 48 61 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 51 70 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 73 89 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 92 107 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 95 115 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 117 130 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 138 155 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 141 162 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 165 176 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 179 191 {ECO:0000255|PROSITE-ProRule:PRU00206}.
DISULFID 187 195 {ECO:0000255|PROSITE-ProRule:PRU00206}.
VAR_SEQ 54 236 Missing (in isoform 8).
{ECO:0000303|PubMed:9114039}.
/FTId=VSP_006492.
VAR_SEQ 54 98 Missing (in isoform 6, isoform 7 and
isoform 9). {ECO:0000303|PubMed:9114039}.
/FTId=VSP_006491.
VAR_SEQ 156 171 SRRDTDCGTCLPGFYE -> HPSVTLGQRPHPSSTS (in
isoform 7). {ECO:0000303|PubMed:9114039}.
/FTId=VSP_006493.
VAR_SEQ 172 417 Missing (in isoform 7).
{ECO:0000303|PubMed:9114039}.
/FTId=VSP_006494.
VAR_SEQ 182 417 Missing (in isoform 5 and isoform 6).
{ECO:0000303|PubMed:9114039}.
/FTId=VSP_006495.
VAR_SEQ 182 277 STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGATLTY
TYRHCWPHKPLVTADEAGMEALTPPPATHLSPLDSAHTLLA
PPDSSEKICTVQLV -> PPPSLAGAPWGAVQSAVPLSVAG
GRVGGVLGMRVGELGWTEGRRVRRGATTQHPPAAFSVLGPG
APGWPCGPPPAWGHPDLHIPPLLASQAPGYCR (in
isoform 12).
{ECO:0000303|PubMed:9446802}.
/FTId=VSP_006499.
VAR_SEQ 182 218 STLGSCPERCAAVCGWRQMFWVQVLLAGLVVPLLLGA ->
VLGPGAPGWPCGPPPAWGHPDLHIPPLLASQAPGYCR (in
isoform 3). {ECO:0000303|PubMed:8934525,
ECO:0000303|PubMed:9114039}.
/FTId=VSP_006497.
VAR_SEQ 182 200 STLGSCPERCAAVCGWRQM -> PPPSLAGAPWGAVQSAVP
LSVAGGRVGV (in isoform 11).
{ECO:0000303|PubMed:9446802}.
/FTId=VSP_006496.
VAR_SEQ 200 253 MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTADEAG
MEALTPPPATHLS -> SRWCAGNARGRTGMDRGEAGEEGG
NHPTPTSCFQCSGSRCSWLALWSPSCLGPP (in
isoform 4). {ECO:0000303|PubMed:8934525,
ECO:0000303|PubMed:9114039}.
/FTId=VSP_006501.
VAR_SEQ 200 237 MFWVQVLLAGLVVPLLLGATLTYTYRHCWPHKPLVTAD ->
N (in isoform 10).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:9114039}.
/FTId=VSP_006503.
VAR_SEQ 219 417 Missing (in isoform 3).
{ECO:0000303|PubMed:8934525,
ECO:0000303|PubMed:9114039}.
/FTId=VSP_006498.
VAR_SEQ 236 236 A -> AA (in isoform 2).
{ECO:0000303|PubMed:9114039}.
/FTId=VSP_006504.
VAR_SEQ 254 417 Missing (in isoform 4).
{ECO:0000303|PubMed:8934525,
ECO:0000303|PubMed:9114039}.
/FTId=VSP_006502.
VAR_SEQ 278 417 Missing (in isoform 12).
{ECO:0000303|PubMed:9446802}.
/FTId=VSP_006500.
VARIANT 23 23 R -> Q (in dbSNP:rs35771371).
{ECO:0000269|Ref.9}.
/FTId=VAR_018826.
VARIANT 159 159 D -> G (in dbSNP:rs11800462).
{ECO:0000269|Ref.7, ECO:0000269|Ref.9}.
/FTId=VAR_018827.
VARIANT 254 254 P -> R (in dbSNP:rs34529016).
{ECO:0000269|Ref.9}.
/FTId=VAR_018828.
VARIANT 370 370 R -> L (in dbSNP:rs1064590).
/FTId=VAR_011814.
VARIANT 381 381 R -> H (in dbSNP:rs1059333).
/FTId=VAR_011815.
MUTAGEN 354 354 L->A: Suppresses homodimerization, TNFR1
interaction, and apoptosis induction.
{ECO:0000269|PubMed:8934525}.
MUTAGEN 356 356 L->A: Suppresses homodimerization, and
TNFR1 interaction.
{ECO:0000269|PubMed:8934525}.
MUTAGEN 373 373 D->A: Suppresses homodimerization, and
TNFR1 interaction.
{ECO:0000269|PubMed:8934525}.
CONFLICT 4 6 RPR -> AAA (in Ref. 12; AAC51192/
AAC51193). {ECO:0000305}.
CONFLICT 60 60 P -> H (in Ref. 13; AAB41435).
{ECO:0000305}.
CONFLICT 167 167 P -> L (in Ref. 12 and 13).
{ECO:0000305}.
CONFLICT 312 312 A -> R (in Ref. 1 and 6). {ECO:0000305}.
SEQUENCE 417 AA; 45385 MW; 5226319DFDB46706 CRC64;
MEQRPRGCAA VAAALLLVLL GARAQGGTRS PRCDCAGDFH KKIGLFCCRG CPAGHYLKAP
CTEPCGNSTC LVCPQDTFLA WENHHNSECA RCQACDEQAS QVALENCSAV ADTRCGCKPG
WFVECQVSQC VSSSPFYCQP CLDCGALHRH TRLLCSRRDT DCGTCLPGFY EHGDGCVSCP
TSTLGSCPER CAAVCGWRQM FWVQVLLAGL VVPLLLGATL TYTYRHCWPH KPLVTADEAG
MEALTPPPAT HLSPLDSAHT LLAPPDSSEK ICTVQLVGNS WTPGYPETQE ALCPQVTWSW
DQLPSRALGP AAAPTLSPES PAGSPAMMLQ PGPQLYDVMD AVPARRWKEF VRTLGLREAE
IEAVEVEIGR FRDQQYEMLK RWRQQQPAGL GAVYAALERM GLDGCVEDLR SRLQRGP


Related products :

Catalog number Product name Quantity
18-661-15010 Tumor necrosis factor receptor superfamily member 25 - WSL-1 protein; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death domain receptor 3; WSL protein; Apoptosis-inducing rec 0.1 mg
EIAAB43347 APO3,Apo-3,Apoptosis-inducing receptor AIR,Apoptosis-mediating receptor DR3,Apoptosis-mediating receptor TRAMP,DDR3,Death receptor 3,DR3,Homo sapiens,Human,LARD,Lymphocyte-associated receptor of death
18-272-195277 DR3 - Rabbit polyclonal to DR3; WSL-1 protein; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death domain receptor 3; WSL protein; Apoptosis-inducing receptor AIR; Apo-3; Lymph 0.05 mg
18-661-15037 Tumor necrosis factor receptor superfamily member 10D - Decoy receptor 2; DcR2; TNF-related apoptosis-inducing ligand receptor 4; TRAIL receptor 4; TRAIL-R4; TRAIL receptor with a truncated death doma 0.1 mg
18-003-42886 Tumor necrosis factor receptor superfamily member 10A - Death receptor 4; TNF-related apoptosis-inducing ligand receptor 1; TRAIL receptor 1; TRAIL-R1; CD261 antigen Polyclonal 0.1 mg Protein A
18-661-15019 Tumor necrosis factor receptor superfamily member 10A - Death receptor 4; TNF-related apoptosis-inducing ligand receptor 1; TRAIL receptor 1; TRAIL-R1; CD261 antigen Polyclonal 0.1 mg
18-001-30087 Tumor necrosis factor receptor superfamily member 10B - Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2; TRAIL receptor 2; TRAIL-R2; CD262 antigen Polyclonal 0.1 mg
18-661-15036 Tumor necrosis factor receptor superfamily member 10B - Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2; TRAIL receptor 2; TRAIL-R2; CD262 antigen Polyclonal 0.1 mg
EIAAB43686 APO2,Death receptor 4,DR4,Homo sapiens,Human,TNF-related apoptosis-inducing ligand receptor 1,TNFRSF10A,TRAIL receptor 1,TRAILR1,TRAIL-R1,Tumor necrosis factor receptor superfamily member 10A
EIAAB43688 Death receptor 5,DR5,Homo sapiens,Human,KILLER,TNF-related apoptosis-inducing ligand receptor 2,TNFRSF10B,TRAIL receptor 2,TRAILR2,TRAIL-R2,TRICK2,Tumor necrosis factor receptor superfamily member 10B
18-661-15097 Tumor necrosis factor receptor superfamily member 10C - Decoy receptor 1; DcR1; Decoy TRAIL receptor without death domain; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; 0.1 mg
18-661-15072 Tumor necrosis factor receptor superfamily member 10C - Decoy receptor 1; DcR1; Decoy TRAIL receptor without death domain; TNF-related apoptosis-inducing ligand receptor 3; TRAIL receptor 3; TRAIL-R3; 0.1 mg
E0030p ELISA kit Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,FAS,FASLG receptor,Pig,Sus scrofa,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T
U0030p CLIA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,FAS,FASLG receptor,Pig,Sus scrofa,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T
E0030p ELISA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,FAS,FASLG receptor,Pig,Sus scrofa,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T
E0030b ELISA kit Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,Bos taurus,Bovine,FAS,FASLG receptor,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T
U0030b CLIA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,Bos taurus,Bovine,FAS,FASLG receptor,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T
E0030b ELISA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,Bos taurus,Bovine,FAS,FASLG receptor,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T
E0030m ELISA kit Apo-1 antigen,Apoptosis-mediating surface antigen FAS,Apt1,Fas,FASLG receptor,Mouse,Mus musculus,Tnfrsf6,Tumor necrosis factor receptor superfamily member 6 96T
E0030r ELISA kit Apo-1 antigen,Apoptosis-mediating surface antigen FAS,Apt1,Fas,FASLG receptor,Rat,Rattus norvegicus,Tnfrsf6,Tumor necrosis factor receptor superfamily member 6 96T
E0030r ELISA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,Apt1,Fas,FASLG receptor,Rat,Rattus norvegicus,Tnfrsf6,Tumor necrosis factor receptor superfamily member 6 96T
U0030m CLIA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,Apt1,Fas,FASLG receptor,Mouse,Mus musculus,Tnfrsf6,Tumor necrosis factor receptor superfamily member 6 96T
E0030m ELISA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,Apt1,Fas,FASLG receptor,Mouse,Mus musculus,Tnfrsf6,Tumor necrosis factor receptor superfamily member 6 96T
U0030r CLIA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,Apt1,Fas,FASLG receptor,Rat,Rattus norvegicus,Tnfrsf6,Tumor necrosis factor receptor superfamily member 6 96T
U0030h CLIA Apo-1 antigen,Apoptosis-mediating surface antigen FAS,APT1,FAS,FAS1,FASLG receptor,Homo sapiens,Human,TNFRSF6,Tumor necrosis factor receptor superfamily member 6 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur