Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Tumor protein p53-inducible nuclear protein 1 (Stress-induced protein) (p53-dependent damage-inducible nuclear protein 1) (p53DINP1)

 T53I1_HUMAN             Reviewed;         240 AA.
Q96A56; B2RCE5; Q969R9;
15-MAR-2005, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
25-OCT-2017, entry version 116.
RecName: Full=Tumor protein p53-inducible nuclear protein 1;
AltName: Full=Stress-induced protein;
AltName: Full=p53-dependent damage-inducible nuclear protein 1;
Short=p53DINP1;
Name=TP53INP1; Synonyms=P53DINP1, SIP;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2),
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, AND FUNCTION.
TISSUE=Thymus;
PubMed=11511362; DOI=10.1016/S1097-2765(01)00284-2;
Okamura S., Arakawa H., Tanaka T., Nakanishi H., Ng C.C., Taya Y.,
Monden M., Nakamura Y.;
"p53DINP1, a p53-inducible gene, regulate p53-dependent apoptosis.";
Mol. Cell 8:85-94(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), INDUCTION, AND TISSUE
SPECIFICITY.
PubMed=12067065; DOI=10.1078/0171-9335-00248;
Tomasini R., Azizi Samir A.L., Pebusque M.-J., Calvo E.L., Totaro S.,
Dagorn J.-C., Dusetti N.J., Iovanna J.L.;
"p53-dependent expression of the stress-induced protein (SIP).";
Eur. J. Cell Biol. 81:294-301(2002).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
INTERACTION WITH TP53 AND HIPK2, AND SUBCELLULAR LOCATION.
PubMed=12851404; DOI=10.1074/jbc.M301979200;
Tomasini R., Samir A.A., Carrier A., Isnardon D., Cecchinelli B.,
Soddu S., Malissen B., Dagorn J.-C., Iovanna J.L., Dusetti N.J.;
"TP53INP1s and homeodomain-interacting protein kinase-2 (HIPK2) are
partners in regulating p53 activity.";
J. Biol. Chem. 278:37722-37729(2003).
[7]
INTERACTION WITH PRKCG.
PubMed=16377624; DOI=10.1074/jbc.M512074200;
Yoshida K., Liu H., Miki Y.;
"Protein kinase C delta regulates Ser46 phosphorylation of p53 tumor
suppressor in the apoptotic response to DNA damage.";
J. Biol. Chem. 281:5734-5740(2006).
[8]
FUNCTION, AND INTERACTION WITH GABARAP; GABARAPL2 AND MAP1LC3A.
PubMed=22421968; DOI=10.1038/cdd.2012.30;
Seillier M., Peuget S., Gayet O., Gauthier C., N'guessan P., Monte M.,
Carrier A., Iovanna J.L., Dusetti N.J.;
"TP53INP1, a tumor suppressor, interacts with LC3 and ATG8-family
proteins through the LC3-interacting region (LIR) and promotes
autophagy-dependent cell death.";
Cell Death Differ. 19:1525-1535(2012).
[9]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH GABARAP;
GABARAPL1; GABARAPL2; MAP1LC3A; MAP1LC3B AND MAP1LC3C.
PubMed=22470510; DOI=10.1371/journal.pone.0034034;
Sancho A., Duran J., Garcia-Espana A., Mauvezin C., Alemu E.A.,
Lamark T., Macias M.J., Desalle R., Royo M., Sala D., Chicote J.U.,
Palacin M., Johansen T., Zorzano A.;
"DOR/Tp53inp2 and Tp53inp1 constitute a metazoan gene family encoding
dual regulators of autophagy and transcription.";
PLoS ONE 7:E34034-E34034(2012).
-!- FUNCTION: Antiproliferative and proapoptotic protein involved in
cell stress response which acts as a dual regulator of
transcription and autophagy. Acts as a positive regulator of
autophagy. In response to cellular stress or activation of
autophagy, relocates to autophagosomes where it interacts with
autophagosome-associated proteins GABARAP, GABARAPL1/L2,
MAP1LC3A/B/C and regulates autophagy. Acts as an antioxidant and
plays a major role in p53/TP53-driven oxidative stress response.
Possesses both a p53/TP53-independent intracellular reactive
oxygen species (ROS) regulatory function and a p53/TP53-dependent
transcription regulatory function. Positively regulates p53/TP53
and p73/TP73 and stimulates their capacity to induce apoptosis and
regulate cell cycle. In response to double-strand DNA breaks,
promotes p53/TP53 phosphorylation on 'Ser-46' and subsequent
apoptosis. Acts as a tumor suppressor by inducing cell death by an
autophagy and caspase-dependent mechanism. Can reduce cell
migration by regulating the expression of SPARC.
{ECO:0000269|PubMed:11511362, ECO:0000269|PubMed:22421968,
ECO:0000269|PubMed:22470510}.
-!- SUBUNIT: Interacts with p53/TP53 and HIPK2. Interacts with PRKCG,
GABARAP, GABARAPL1, GABARAPL2, MAP1LC3A, MAP1LC3B AND MAP1LC3C.
{ECO:0000269|PubMed:12851404, ECO:0000269|PubMed:16377624,
ECO:0000269|PubMed:22421968, ECO:0000269|PubMed:22470510}.
-!- INTERACTION:
Q9H0R8:GABARAPL1; NbExp=4; IntAct=EBI-9986117, EBI-746969;
Q9BXW4:MAP1LC3C; NbExp=4; IntAct=EBI-9986117, EBI-2603996;
-!- SUBCELLULAR LOCATION: Cytoplasm, cytosol. Nucleus. Nucleus, PML
body. Cytoplasmic vesicle, autophagosome. Note=Shuttles between
the nucleus and the cytoplasm, depending on cellular stress
conditions, and re-localizes to autophagosomes on autophagy
activation.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=p53DINP1a, alpha, SIP27, TEAP;
IsoId=Q96A56-1; Sequence=Displayed;
Name=2; Synonyms=p53DINP1b, beta, SIP18;
IsoId=Q96A56-2; Sequence=VSP_013176;
-!- TISSUE SPECIFICITY: Ubiquitously expressed.
{ECO:0000269|PubMed:11511362, ECO:0000269|PubMed:12067065}.
-!- INDUCTION: By adriamycin, gamma irradiation and H(2)O(2), in a
p53/TP53-dependent way. At lower levels by UV irradiation. By
TP73. {ECO:0000269|PubMed:11511362, ECO:0000269|PubMed:12067065}.
-!- DOMAIN: The LC3 interacting region (LIR) motif mediates
interaction with GABARAP, GABARAPL1, GABARAPL2, MAP1LC3A, MAP1LC3B
and MAP1LC3C.
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/TP53INP1ID42672ch8q22.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB017926; BAB62149.1; -; mRNA.
EMBL; AB017927; BAB62150.1; -; mRNA.
EMBL; AB062056; BAB62151.1; -; Genomic_DNA.
EMBL; AB062056; BAB62152.1; -; Genomic_DNA.
EMBL; AF409114; AAL04513.1; -; mRNA.
EMBL; AF409115; AAL04514.1; -; mRNA.
EMBL; AK315071; BAG37542.1; -; mRNA.
EMBL; CH471060; EAW91740.1; -; Genomic_DNA.
EMBL; BC074813; AAH74813.1; -; mRNA.
EMBL; BC074868; AAH74868.1; -; mRNA.
CCDS; CCDS47899.1; -. [Q96A56-2]
CCDS; CCDS6265.1; -. [Q96A56-1]
RefSeq; NP_001129205.1; NM_001135733.1. [Q96A56-2]
RefSeq; NP_150601.1; NM_033285.3. [Q96A56-1]
RefSeq; XP_011515688.1; XM_011517386.2. [Q96A56-1]
UniGene; Hs.492261; -.
ProteinModelPortal; Q96A56; -.
BioGrid; 125152; 12.
IntAct; Q96A56; 5.
STRING; 9606.ENSP00000344215; -.
iPTMnet; Q96A56; -.
PhosphoSitePlus; Q96A56; -.
BioMuta; TP53INP1; -.
DMDM; 61216823; -.
PaxDb; Q96A56; -.
PeptideAtlas; Q96A56; -.
PRIDE; Q96A56; -.
DNASU; 94241; -.
Ensembl; ENST00000342697; ENSP00000344215; ENSG00000164938. [Q96A56-1]
Ensembl; ENST00000448464; ENSP00000390063; ENSG00000164938. [Q96A56-2]
GeneID; 94241; -.
KEGG; hsa:94241; -.
UCSC; uc003yhg.4; human. [Q96A56-1]
CTD; 94241; -.
DisGeNET; 94241; -.
EuPathDB; HostDB:ENSG00000164938.13; -.
GeneCards; TP53INP1; -.
HGNC; HGNC:18022; TP53INP1.
HPA; HPA005856; -.
MIM; 606185; gene.
neXtProt; NX_Q96A56; -.
OpenTargets; ENSG00000164938; -.
PharmGKB; PA38278; -.
eggNOG; ENOG410IJ9V; Eukaryota.
eggNOG; ENOG4111S9D; LUCA.
GeneTree; ENSGT00530000063829; -.
HOGENOM; HOG000010288; -.
HOVERGEN; HBG055647; -.
InParanoid; Q96A56; -.
KO; K15310; -.
OMA; WAVHQPC; -.
OrthoDB; EOG091G0FZC; -.
PhylomeDB; Q96A56; -.
TreeFam; TF333017; -.
Reactome; R-HSA-6803204; TP53 Regulates Transcription of Genes Involved in Cytochrome C Release.
Reactome; R-HSA-6804756; Regulation of TP53 Activity through Phosphorylation.
SIGNOR; Q96A56; -.
ChiTaRS; TP53INP1; human.
GeneWiki; TP53INP1; -.
GenomeRNAi; 94241; -.
PRO; PR:Q96A56; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000164938; -.
CleanEx; HS_TP53INP1; -.
ExpressionAtlas; Q96A56; baseline and differential.
Genevisible; Q96A56; HS.
GO; GO:0005776; C:autophagosome; IDA:UniProtKB.
GO; GO:0031410; C:cytoplasmic vesicle; IEA:UniProtKB-KW.
GO; GO:0005829; C:cytosol; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0016605; C:PML body; IEA:UniProtKB-SubCell.
GO; GO:0016209; F:antioxidant activity; ISS:UniProtKB.
GO; GO:0006915; P:apoptotic process; IEA:UniProtKB-KW.
GO; GO:0048102; P:autophagic cell death; IMP:UniProtKB.
GO; GO:0000045; P:autophagosome assembly; IBA:GO_Central.
GO; GO:0007050; P:cell cycle arrest; TAS:UniProtKB.
GO; GO:0071361; P:cellular response to ethanol; IEA:Ensembl.
GO; GO:0071447; P:cellular response to hydroperoxide; IEA:Ensembl.
GO; GO:0072703; P:cellular response to methyl methanesulfonate; IEA:Ensembl.
GO; GO:0034644; P:cellular response to UV; IEA:Ensembl.
GO; GO:0030336; P:negative regulation of cell migration; ISS:UniProtKB.
GO; GO:0008285; P:negative regulation of cell proliferation; ISS:UniProtKB.
GO; GO:0048147; P:negative regulation of fibroblast proliferation; IEA:Ensembl.
GO; GO:0010629; P:negative regulation of gene expression; IEA:Ensembl.
GO; GO:1904761; P:negative regulation of myofibroblast differentiation; IEA:Ensembl.
GO; GO:2001235; P:positive regulation of apoptotic signaling pathway; IEA:Ensembl.
GO; GO:0010508; P:positive regulation of autophagy; IMP:UniProtKB.
GO; GO:0045893; P:positive regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0042981; P:regulation of apoptotic process; TAS:Reactome.
GO; GO:1901796; P:regulation of signal transduction by p53 class mediator; TAS:Reactome.
GO; GO:0009408; P:response to heat; IEA:Ensembl.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
InterPro; IPR029431; TP53INP.
InterPro; IPR029556; TP53INP1.
PANTHER; PTHR31671; PTHR31671; 1.
PANTHER; PTHR31671:SF0; PTHR31671:SF0; 1.
Pfam; PF14839; DOR; 1.
1: Evidence at protein level;
Activator; Alternative splicing; Antioxidant; Apoptosis; Autophagy;
Complete proteome; Cytoplasm; Cytoplasmic vesicle; Nucleus;
Polymorphism; Reference proteome; Transcription;
Transcription regulation; Tumor suppressor.
CHAIN 1 240 Tumor protein p53-inducible nuclear
protein 1.
/FTId=PRO_0000072406.
MOTIF 25 37 LIR.
COMPBIAS 14 17 Poly-Ser.
COMPBIAS 20 61 Glu-rich.
VAR_SEQ 159 240 VEAQNEMGQHIHCYVAALAAHTTFLEQPKSFRPSQWIKEHS
ERQPLNRNSLRRQNLTRDCHPRQVKHNGWVVHQPCPRQYNY
-> ARKSCL (in isoform 2).
{ECO:0000303|PubMed:11511362,
ECO:0000303|PubMed:12067065}.
/FTId=VSP_013176.
VARIANT 75 75 C -> R (in dbSNP:rs11991800).
/FTId=VAR_051404.
SEQUENCE 240 AA; 27366 MW; 1950D66EDDB4A186 CRC64;
MFQRLNKMFV GEVSSSSNQE PEFNEKEDDE WILVDFIDTC TGFSAEEEEE EEDISEESPT
EHPSVFSCLP ASLECLADTS DSCFLQFESC PMEESWFITP PPCFTAGGLT TIKVETSPME
NLLIEHPSMS VYAVHNSCPG LSEATRGTDE LHSPSSPRVE AQNEMGQHIH CYVAALAAHT
TFLEQPKSFR PSQWIKEHSE RQPLNRNSLR RQNLTRDCHP RQVKHNGWVV HQPCPRQYNY


Related products :

Catalog number Product name Quantity
EIAAB41167 Homo sapiens,Human,p53-dependent damage-inducible nuclear protein 1,p53DINP1,P53DINP1,SIP,Stress-induced protein,TP53INP1,Tumor protein p53-inducible nuclear protein 1
EIAAB41166 p53-dependent damage-inducible nuclear protein 1,p53DINP1,Rat,Rattus norvegicus,Sip,Stress-induced protein,TEAP,Thymus-expressed acidic protein,Trp53inp1,Tumor protein p53-inducible nuclear protein 1
EIAAB41165 Mouse,Mus musculus,p53-dependent damage-inducible nuclear protein 1,p53DINP1,Sip,Stress-induced protein,TEAP,Thymus-expressed acidic protein,Trp53inp1,Tumor protein p53-inducible nuclear protein 1
18-661-15138 Tumor protein p53-inducible nuclear protein 1 - p53-dependent damage-inducible nuclear protein 1; p53DINP1; Stress-induced protein Polyclonal 0.1 mg
EIAAB41170 C20orf110,Homo sapiens,Human,p53-inducible protein U,PIG-U,PINH,TP53INP2,Tumor protein p53-inducible nuclear protein 2
EIAAB29586 Mouse,Mus musculus,p53-induced gene 11 protein,Pig11,Tp53i11,Transformation related protein 53 inducible protein 11,Trp53i11,Tumor protein p53-inducible protein 11
EIAAB10733 Ddit4,Dexamethasone-induced gene 2 protein,Dig2,DNA damage-inducible transcript 4 protein,HIF-1 responsive protein RTP801,Mouse,Mus musculus,Protein regulated in development and DNA damage response 1,
EIAAB41169 Diabetes and obesity-regulated protein,Dor,Mouse,Mus musculus,Tp53inp2,Trp53inp2,Tumor protein p53-inducible nuclear protein 2
EIAAB42118 Head and neck tumor and metastasis-related protein,Homo sapiens,Human,MDC-3.13,NDED,NF-kappa-B-inducible DED-containing protein,SCC-S2,TNF alpha-induced protein 8,TNFAIP8,TNF-induced protein GG2-1,Tum
EIAAB37304 Cytokine-induced protein of 29 kDa,HCC1,Homo sapiens,HSPC316,Human,Nuclear protein Hcc-1,Proliferation-associated cytokine-inducible protein CIP29,SAP domain-containing ribonucleoprotein,SARNP
H9525 Tumor protein p53-inducible nuclear protein 2 (TP53INP2), Human, ELISA Kit 96T
H9526 Tumor protein p53-inducible nuclear protein 2 (TP53INP2), Mouse, ELISA Kit 96T
CSB-EL024086MO Mouse Tumor protein p53-inducible nuclear protein 2(TP53INP2) ELISA kit 96T
CSB-EL024086RA Rat Tumor protein p53-inducible nuclear protein 2(TP53INP2) ELISA kit SpeciesRat 96T
H9524 Tumor protein p53-inducible nuclear protein 1 (TP53INP1), Human, ELISA Kit 96T
CSB-EL024085HU Human Tumor protein p53-inducible nuclear protein 1(TP53INP1) ELISA kit 96T
CSB-EL024086HU Human Tumor protein p53-inducible nuclear protein 2(TP53INP2) ELISA kit 96T
CSB-EL024086RA Rat Tumor protein p53-inducible nuclear protein 2(TP53INP2) ELISA kit 96T
E1164b Mouse ELISA Kit FOR Tumor protein p53-inducible nuclear protein 1 96T
H9527 Tumor protein p53-inducible nuclear protein 2 (TP53INP2), Rat, ELISA Kit 96T
T53I1_RAT ELISA Kit FOR Tumor protein p53-inducible nuclear protein 1; organism: Rat; gene name: Trp53inp1 96T
T53I2_RAT ELISA Kit FOR Tumor protein p53-inducible nuclear protein 2; organism: Rat; gene name: Tp53inp2 96T
CSB-EL024085HU Human Tumor protein p53-inducible nuclear protein 1(TP53INP1) ELISA kit SpeciesHuman 96T
CSB-EL024086MO Mouse Tumor protein p53-inducible nuclear protein 2(TP53INP2) ELISA kit SpeciesMouse 96T
CSB-EL024086HU Human Tumor protein p53-inducible nuclear protein 2(TP53INP2) ELISA kit SpeciesHuman 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur